KEGG   Bos taurus (cow): 281125Help
Entry
281125            CDS       T01008                                 

Gene name
DRD1
Definition
(RefSeq) D(1A) dopamine receptor
  KO
K04144  dopamine receptor D1
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04024  cAMP signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04540  Gap junction
bta04728  Dopaminergic synapse
bta05012  Parkinson disease
bta05030  Cocaine addiction
bta05031  Amphetamine addiction
bta05032  Morphine addiction
bta05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    281125 (DRD1)
   04024 cAMP signaling pathway
    281125 (DRD1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    281125 (DRD1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    281125 (DRD1)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    281125 (DRD1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    281125 (DRD1)
  09165 Substance dependence
   05030 Cocaine addiction
    281125 (DRD1)
   05031 Amphetamine addiction
    281125 (DRD1)
   05032 Morphine addiction
    281125 (DRD1)
   05034 Alcoholism
    281125 (DRD1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    281125 (DRD1)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    281125 (DRD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx DUF621
Motif
Other DBs
NCBI-GeneID: 281125
NCBI-ProteinID: NP_776467
BGD-bta: BT10011
Ensembl: ENSBTAG00000047719
VGNC: 28207
UniProt: Q95136
Position
10
AA seq 446 aa AA seqDB search
MRTLNTSTMEGTGLVAERDFSFRILTACFLSLLILSTLLGNTLVCAAVIRFRHLRSKVTN
FFVISLAVSDLLVAVLVMPWKAVAEIAGFWPFGSFCNIWVAFDIMCSTASILNLCVISVD
RYWAISSPFRYERKMTPKAAFILISVAWTLSVLISFIPVQLSWHKAKPTGPSEGNATSLG
KTINNCDSSLSRTYAISSSLISFYIPVAIMIVTYTRIYRIAQKQIRRISALERAAVHAKN
CQTTTGNGNPMECSQPESSFKMSFKRETKVLKTLSVIMGVFVCCWLPFFILNCMVPFCGS
GETKPFCIDSITFDVFVWFGWANSSLNPIIYAFNADFRKAFSTLLGCYRLCPTTNNAIET
VSINNNGAVVFSSHHEPRGSISKDCNVVYLIPHAVGSSEGLKKEEAVGIAKPLEKLSPAL
SVILDYDTDVSLEKIQPITQNGQHPT
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaggactctcaacacgtctaccatggaaggcaccgggctggtggcggagagggacttc
tccttccgcattctcacagcctgtttcctgtcgctgcttatcctgtccaccctcctgggg
aacacgctggtctgtgccgccgtgatcaggttccgccacctgcgatccaaggtgaccaac
ttcttcgtcatctccttggctgtatcggatctcttggtggccgtcttggtcatgccctgg
aaagcagtggccgagatcgctggcttctggcccttcgggtccttctgtaacatctgggtg
gcctttgacatcatgtgctccaccgcatccatcctcaatctctgtgtgatcagtgtggac
aggtattgggccatctctagccccttccggtatgagaggaagatgacccccaaggcagcc
ttcattctgatcagtgtggcatggactttgtcggttcttatctccttcatccccgtgcag
ctcagctggcacaaggcgaaacccacaggtccctctgaggggaatgccacttccctgggc
aagaccatcaacaactgtgactccagcttgagcaggacatatgccatttcatcctctcta
ataagcttttacatccctgtggccatcatgattgtcacctacaccaggatctacaggatc
gcccagaaacaaatacggcgtatctcagccttggagagggcagcagtccatgccaagaac
tgccagaccactacaggtaatggaaaccccatggagtgttctcaaccagaaagctccttt
aagatgtccttcaaaagagagactaaagttctgaagactctgtcagtgatcatgggggtg
ttcgtgtgctgctggctccctttcttcatcttgaactgcatggtgcccttctgtgggtct
ggagagaccaagcccttctgcatcgattccatcacctttgacgtgtttgtgtggtttggg
tgggctaattcctccttgaaccccatcatttatgcctttaatgctgattttcggaaggca
ttttccaccctcttaggatgctacaggctttgcccgacgacgaataatgccatagagacg
gttagcatcaataacaatggggctgtggtgttttccagccatcacgagcctcggggttcc
atctccaaggactgcaatgtggtgtatctgatcccacacgctgtgggctcctctgagggc
ctgaagaaggaggaggcggtgggaatagccaagcccttggagaagctgtccccagccctg
tctgtcattttggactatgacactgacgtctctcttgagaagatccagcccatcacacaa
aacgggcagcacccgacctga

DBGET integrated database retrieval system