KEGG   Bos taurus (cow): 281126
Entry
281126            CDS       T01008                                 

Symbol
DRD2
Name
(RefSeq) D(2) dopamine receptor
  KO
K04145  dopamine receptor D2
Organism
bta  Bos taurus (cow)
Pathway
bta04015  Rap1 signaling pathway
bta04024  cAMP signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04540  Gap junction
bta04728  Dopaminergic synapse
bta05012  Parkinson disease
bta05030  Cocaine addiction
bta05034  Alcoholism
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    281126 (DRD2)
   04024 cAMP signaling pathway
    281126 (DRD2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    281126 (DRD2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    281126 (DRD2)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    281126 (DRD2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    281126 (DRD2)
  09165 Substance dependence
   05030 Cocaine addiction
    281126 (DRD2)
   05034 Alcoholism
    281126 (DRD2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    281126 (DRD2)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Dopamine
    281126 (DRD2)
SSDB
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srv Stevor RIFIN
Other DBs
NCBI-GeneID: 281126
NCBI-ProteinID: NP_776468
BGD-bta: BT11104
Ensembl: ENSBTAG00000010860
UniProt: P20288
Position
15
AA seq 444 aa
MDPLNLSWYDDDPESRNWSRPFNGSEGKADRPPYNYYAMLLTLLIFVIVFGNVLVCMAVS
REKALQTTTNYLIVSLAVADLLVATLVMPWVVYLEVVGEWKFSRIHCDIFVTLDVMMCTA
SILNLCAISIDRYTAVAMPMLYNTRYSSKRRVTVMIAIVWVLSFTISCPMLFGLNNTDQN
ECIIANPAFVVYSSIVSFYVPFIVTLLVYIKIYIVLRRRRKRVNTKRSSRAFRANLKAPL
KGNCTHPEDMKLCTVIMKSNGSFPVNRRRVEAARRAQELEMEMLSSTSPPERTRYSPIPP
SHHQLTLPDPSHHGLHSTPDSPAKPEKNGHAKTVNPKIAKIFEIQSMPNGKTRTSLKTMS
RRKLSQQKEKKATQMLAIVLGVFIICWLPFFITHILNIHCDCNIPPVLYSAFTWLGYVNS
AVNPIIYTTFNIEFRKAFLKILHC
NT seq 1335 nt   +upstreamnt  +downstreamnt
atggatccgctgaacctgtcctggtatgatgatgatccagagagccggaactggagccgg
cccttcaatgggtccgaagggaaggctgacaggcccccctacaactactatgccatgctg
ctcaccctgctcatcttcgtcatcgtctttggcaacgtgctggtgtgcatggctgtgtcc
cgcgagaaggcgctgcagaccaccaccaactacctgatcgtcagcctcgctgtggctgac
ctcctggtggccacgctggtcatgccctgggtggtctacctggaggtggtgggcgagtgg
aaattcagcaggattcactgtgacatctttgtcaccctggatgtcatgatgtgcacagcc
agcatcctgaacctgtgtgccatcagcattgacaggtacacagccgtggccatgcccatg
ctctacaacacacgttacagctccaagcgccgggtcacggtcatgatcgccatcgtctgg
gtcctgtccttcaccatctcctgcccgatgctcttcggactcaacaacacagaccagaac
gagtgcatcatcgccaaccccgccttcgtggtctactcctccatcgtctccttctacgtg
cccttcatcgtcaccctgctggtctacatcaagatctacatcgtcctccgcaggcggcgc
aagcgcgtcaacaccaagcgcagcagccgggctttccgggccaacctgaaggccccgctc
aagggcaactgtactcaccccgaggacatgaaactctgcaccgttatcatgaagtctaat
gggagtttcccagtgaacaggcggagagtggaggccgcccgccgagcccaggagctagag
atggagatgctctccagcaccagcccgcctgagaggacccgatacagccccatccctccc
agccaccaccagctgaccctccccgacccatcccaccacggcctgcatagcacacccgac
agtcccgccaaaccagagaagaacgggcatgccaagaccgtcaatcccaagattgccaag
atctttgagatccagtccatgcccaatggcaaaacccggacctctctcaagaccatgagc
cgcagaaagctctcccagcagaaggagaagaaggccacccagatgctcgccattgttctc
ggcgtgttcatcatctgctggctgcccttcttcatcacccacatcctgaacatacactgt
gactgcaacatcccgcccgtgctgtacagcgccttcacgtggctgggctacgtcaacagc
gccgtgaaccccatcatctacaccaccttcaacatcgagttccgcaaggccttcctgaag
atcctacactgctga

DBGET integrated database retrieval system