KEGG   Bos taurus (cow): 281137
Entry
281137            CDS       T01008                                 

Gene name
EDN1
Definition
(RefSeq) endothelin-1 precursor
  KO
K16366  endothelin-1
Organism
bta  Bos taurus (cow)
Pathway
bta04024  cAMP signaling pathway
bta04066  HIF-1 signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04270  Vascular smooth muscle contraction
bta04668  TNF signaling pathway
bta04916  Melanogenesis
bta04924  Renin secretion
bta04926  Relaxin signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05200  Pathways in cancer
bta05410  Hypertrophic cardiomyopathy
bta05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    281137 (EDN1)
   04066 HIF-1 signaling pathway
    281137 (EDN1)
   04024 cAMP signaling pathway
    281137 (EDN1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    281137 (EDN1)
 09150 Organismal Systems
  09152 Endocrine system
   04926 Relaxin signaling pathway
    281137 (EDN1)
   04916 Melanogenesis
    281137 (EDN1)
   04924 Renin secretion
    281137 (EDN1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    281137 (EDN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    281137 (EDN1)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    281137 (EDN1)
   05410 Hypertrophic cardiomyopathy
    281137 (EDN1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    281137 (EDN1)
SSDB
Motif
Pfam: Endothelin
Other DBs
NCBI-GeneID: 281137
NCBI-ProteinID: NP_851353
BGD-bta: BT10530
Ensembl: ENSBTAG00000008096
VGNC: 28327
UniProt: P17322
Position
23
AA seq 202 aa
MDYFPMIFALLFVAFQGAPEAAVLGTELSAGAEDGGEKPAPATPWRPRRSKRCSCSSLMD
KECVYFCHLDIIWVNTPEHVVPYGLGSPSRSKRSLKDFFPTKATVHRKRCQCASQTDKKC
WNFCQAGKELRDQDSMEKAWNNQKRGKDCSKLGEKCLHQQLVAGRKTRRLEAISNSIKTS
FRVAKLKAQLYRDKKVIYNRAH
NT seq 609 nt   +upstreamnt  +downstreamnt
atggattatttccccatgattttcgctctgctgtttgtggctttccaaggagctccagaa
gcagcggtcctgggcaccgagctcagcgcgggagcagaggatggcggggagaagccggct
cccgccacgccctggaggccccgccggtccaagcgctgctcctgctcttccctgatggat
aaagagtgtgtctacttctgccatctggacatcatctgggtcaacactccagagcacgtt
gttccgtatggactcggaagcccttctaggtccaagcgctccttaaaggacttctttcct
acaaaggcgacagtccacaggaagagatgccagtgtgctagccagacagacaagaaatgc
tggaatttttgccaagcaggaaaagaactcagggaccaagactccatggagaaagcctgg
aacaaccaaaagagagggaaagactgttctaagctaggagagaagtgtcttcatcagcag
ctcgtggccggaagaaaaacaagaaggttggaggccatcagcaacagcatcaaaacatct
tttcgtgttgccaagctgaaagcccagctctacagagataagaaagtgatctacaaccgt
gctcactga

DBGET integrated database retrieval system