KEGG   Bos taurus (cow): 281138
Entry
281138            CDS       T01008                                 

Gene name
EEF2
Definition
(RefSeq) elongation factor 2
  KO
K03234  elongation factor 2
Organism
bta  Bos taurus (cow)
Pathway
bta04152  AMPK signaling pathway
bta04921  Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04152 AMPK signaling pathway
    281138 (EEF2)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    281138 (EEF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:bta03012]
    281138 (EEF2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    281138 (EEF2)
Translation factors [BR:bta03012]
 Eukaryotic type
  Elongation factors
   281138 (EEF2)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   281138 (EEF2)
SSDB
Motif
Pfam: GTP_EFTU EFG_IV EFG_C EFG_III GTP_EFTU_D2 MMR_HSR1
Other DBs
NCBI-GeneID: 281138
NCBI-ProteinID: NP_001068589
Ensembl: ENSBTAG00000004258
VGNC: 28335
UniProt: Q3SYU2
Position
7
AA seq 858 aa
MVNFTVDQIRAIMDKKANIRNMSVIAHVDHGKSTLTDSLVCKAGIIASARAGETRFTDTR
KDEQERCITIKSTAISLFYELSENDLNFIKQSKDGSGFLINLIDSPGHVDFSSEVTAALR
VTDGALVVVDCVSGVCVQTETVLRQAIAERIKPVLMMNKMDRALLELQLEPEELYQTFQR
IVENVNVIISTYGEGESGPMGNIMIDPVLGTVGFGSGLHGWAFTLKQFAEMYVAKFAAKG
EGQLGPAERAKKVEDMMKKLWGDRYFDPATGKFSKSANSPDGKKLPRTFCQLILDPIFKV
FDAIMNFKKEETAKLIEKLDIKLDSEDKDKEGKPLLKAVMRRWLPAGDALLQMITIHLPS
PVTAQKYRCELLYEGPPDDEAAMGIKSCDPKGPLMMYISKMVPTSDKGRFYAFGRVFSGL
VSTGLKVRIMGPNYTPGKKEDLYLKPIQRTILMMGRYVEPIEDVPCGNIVGLVGVDQFLV
KTGTITTFEHAHNMRVMKFSVSPVVRVAVEAKNPADLPKLVEGLKRLAKSDPMVQCIIEE
SGEHIIAGAGELHLEICLKDLEEDHACIPIKKSDPVVSYRETVSEESNVLCLSKSPNKHN
RLYMKARPFPDGLAEDIDKGEVSARQELKQRARYLAEKYEWDVAEARKIWCFGPDGTGPN
ILTDITKGVQYLNEIKDSVVAGFQWATKEGALCEENMRGVRFDVHDVTLHADAIHRGGGQ
IIPTARRCLYASVLTAQPRLMEPIYLVEIQCPEQVVGGIYGVLNRKRGHVFEETQVAGTP
MFVVKAYLPVNESFGFTADLRSNTGGQAFPQCVFDHWQILPGDPFDNTSRPSQVVAETRK
RKGLKEGIPALDNFLDKL
NT seq 2577 nt   +upstreamnt  +downstreamnt
atggtgaacttcacagtagaccagatccgggccatcatggacaagaaggccaacatccgg
aacatgtctgtcattgcccacgtggaccatggcaaatccactctgacggactcccttgtg
tgcaaggcgggtatcatcgcctctgcccgggctggggagacccgcttcactgacacccgg
aaggatgagcaggagcgttgcatcaccatcaagtcaacggccatctcccttttctacgag
ctttcagagaacgacttgaatttcatcaagcagagcaaggatggctctggcttcctcatc
aacctcatcgactcccctgggcacgtcgacttttcctcagaggtgacagctgcactccgt
gtcactgacggtgccttggtggtggtggactgcgtgtcgggtgtgtgtgtgcagacagag
acggtgctgcgccaggccatcgctgagcgcatcaagccagtgctgatgatgaacaagatg
gaccgggccctgcttgagctgcagctggagcctgaggagctctaccaaaccttccagcgc
atcgtggagaacgtcaacgtcatcatctccacttacggcgagggcgagagcggccccatg
ggcaacatcatgatcgaccccgtccttggtactgttggcttcgggtctggtctccacggt
tgggcctttaccctgaagcagtttgccgagatgtatgtggccaagtttgctgccaagggc
gagggacagctagggcctgctgagcgggccaagaaggtggaggacatgatgaaaaagctg
tggggagaccggtactttgatccagccaccggcaagttcagcaagtcagccaacagccct
gatggcaagaagctgccacggacgttctgccagctcatcctggacccaatcttcaaggtg
tttgatgcaatcatgaacttcaagaaagaggagactgcaaaactaattgaaaaactggac
atcaagttggacagtgaagataaggacaaggagggcaaaccgcttctgaaggctgtgatg
cgccgctggctgcctgctggggatgccctgctgcagatgatcaccatccacctgccttcc
cctgtgacggcccagaagtaccgctgtgagctcctgtacgaggggcccccagacgatgag
gcagccatgggcattaaaagctgtgatcccaaaggccctctcatgatgtacatttccaaa
atggtgccgacctctgacaaaggtcggttctatgctttcggccgggtcttctcagggctg
gtgtctactggcctgaaggtccgcatcatgggacccaactatactcctgggaagaaggag
gacctgtacctgaagccgatccagaggacaatcctgatgatgggccgttacgtggagccc
atcgaggatgtgccttgtggcaacattgtgggcctggtgggcgtggaccagttcctggtg
aagactggcaccatcaccacctttgagcatgcccacaacatgcgggtgatgaagttcagt
gtgagccctgttgtcagggttgctgtggaggccaagaacccggccgacctgcccaagctg
gtggaaggtctgaagcggctggccaagtcggaccccatggtgcagtgcatcatcgaggag
tccggggagcacattatcgcgggggctggggagctgcacttggagatctgcctcaaggac
ctggaggaggatcacgcttgcatccccatcaagaaatctgacccagttgtctcgtaccgg
gagactgtcagcgaggagtcaaacgtgctctgcctatccaagtcccccaacaagcacaat
aggctttatatgaaggcgcggcccttccctgacggcctggctgaggacatcgacaagggc
gaggtgtccgcccgccaggagctcaagcagcgggcccgctacctggctgagaagtacgag
tgggatgtggccgaggcccgtaagatctggtgcttcggccctgatggcacgggccccaac
atcctcacggacatcaccaagggtgtgcaatacctcaatgaaatcaaggacagtgtggta
gctggcttccagtgggccaccaaagagggggcactgtgcgaggagaacatgcggggcgtg
cgctttgacgtccatgatgtgacgctgcacgctgatgccatccaccgtgggggtggccag
atcatccccacggctcggcgctgcctgtatgccagtgtgctgactgcccagccccggctc
atggagcccatctatcttgtggagatccagtgtccagaacaagtggttggtggcatctac
ggtgtcctgaacaggaagcggggccacgtctttgaggagacccaggtggccggcaccccc
atgtttgttgtgaaggcctaccttcctgtcaatgagtcctttggcttcactgctgacctg
aggtccaacacgggcggccaggccttcccccagtgtgtgttcgaccactggcagatcctg
cccggtgacccctttgacaacaccagccgccccagtcaggtagtggcggagacacgcaag
cgcaaaggcctgaaggaaggcatcccagccctggacaacttcctggacaagttgtag

DBGET integrated database retrieval system