KEGG   Bos taurus (cow): 281169
Entry
281169            CDS       T01008                                 

Gene name
FNTA
Definition
(RefSeq) protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha
  KO
K05955  protein farnesyltransferase/geranylgeranyltransferase type-1 subunit alpha [EC:2.5.1.58 2.5.1.59]
Organism
bta  Bos taurus (cow)
Pathway
bta00900  Terpenoid backbone biosynthesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    281169 (FNTA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:bta01006]
    281169 (FNTA)
Enzymes [BR:bta01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.58  protein farnesyltransferase
     281169 (FNTA)
    2.5.1.59  protein geranylgeranyltransferase type I
     281169 (FNTA)
Prenyltransferases [BR:bta01006]
 Protein prenylation
  Farnesyltransferase/geranylgeranyltransferase 1
   281169 (FNTA)
SSDB
Motif
Pfam: PPTA
Other DBs
NCBI-GeneID: 281169
NCBI-ProteinID: NP_803464
BGD-bta: BT29494
Ensembl: ENSBTAG00000003201
VGNC: 29070
UniProt: P29702 F1N081
Position
27
AA seq 375 aa
MAAADGVGEAAQGGDPGQPEPPPPPQPHPPPPPPQPPQEEAAAASPMDDGFLSLDSPTYV
LYRDRPEWADIDPVPQNDGPNPVVQIIYSEKFQDVYDYFRAVLQRDERSERAFKLTRDAI
ELNAANYTVWHFRRVLLKSLQKDLHEEMNYISAIIEEQPKNYQVWHHRRVLVEWLRDPSQ
ELEFIADILTQDAKNYHAWQHRQWVIQEFKLWDNELQYVDQLLKEDVRNNSVWNQRYFVI
SNTTGYNDRAILEREVQYTLEMIKLVPHNESAWNYLKGILQDRGLSKYPNLLNQLLDLQP
SHSSPYLIAFLVDIYEDMLENQCDNKEDILNKALELCEILAKEKDTIRKEYWRYIGRSLQ
SKHSTESDPPTNVQQ
NT seq 1128 nt   +upstreamnt  +downstreamnt
atggcggccgccgacggggtcggggaggccgcgcagggcggggatcccggtcagccggag
ccgccgcctcctcctcagccccatcctcctccgccgcctccccagccgccgcaggaagag
gcggcggcggcgtcccctatggacgacgggttcctgagcctggactctcccacctatgtc
ctgtacagggacaggccagaatgggctgatatagatccagtgccgcagaatgatggcccc
aatccagtggtccagatcatttatagtgagaaatttcaggacgtctatgattatttccgg
gctgtcctgcagcgcgacgagagaagtgagcgggcttttaaattaaccagagatgctatt
gagttaaatgcagccaactacacagtgtggcatttccgaagagttctcttaaagtcactt
cagaaggatctacatgaggaaatgaactacatctcggcaataattgaggagcagcccaaa
aactatcaagtttggcatcataggcgagtgctggtggaatggctgagagacccatcacag
gagcttgagtttattgcggatattcttactcaggatgcaaagaattaccatgcctggcag
caccgacagtgggttattcaggaatttaaactttgggataatgagctgcagtatgtagac
caacttctcaaagaggatgtgagaaataactctgtctggaaccaaagatatttcgtaatt
tctaacactacgggctacaatgatcgtgctatattggagagagaagtccagtacactctg
gaaatgatcaaactagtcccacataatgaaagtgcgtggaattatttgaaagggattttg
caggatcgtggtctttccaaatatcccaatctgttaaatcaattacttgacttacaacca
agtcacagctctccctacctaattgcctttcttgtggatatctatgaagacatgctagaa
aaccaatgtgacaacaaggaggacattcttaataaagcgttagagttatgtgaaatctta
gctaaagaaaaggacactataagaaaggaatattggagatatattggaagatcccttcaa
agcaaacacagcacagaaagtgacccacctacaaacgtacagcaataa

DBGET integrated database retrieval system