KEGG   Bos taurus (cow): 281231Help
Entry
281231            CDS       T01008                                 

Gene name
HRH1
Definition
(RefSeq) histamine H1 receptor
  KO
K04149  histamine receptor H1
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04750  Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    281231 (HRH1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    281231 (HRH1)
 09150 Organismal Systems
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    281231 (HRH1)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Histamine
    281231 (HRH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 281231
NCBI-ProteinID: NP_776508
BGD-bta: BT17475
Ensembl: ENSBTAG00000001447
UniProt: A5D795
Position
22
AA seq 491 aa AA seqDB search
MTCPNSSCVFEDKMCEGNKTAPANNAQLTPLVVVLSTISLVTVGLNLLVLYAVRSERKLH
TVGNLYIVSLSVADLIVGVVVMPMNILYLLMSRWSLGRPLCLFWLSMDYVASTASIFSVF
ILCIDRYRSVQQPLKYLRYRTKTRASITILAAWFLSFLWIIPILGWRHFQPKTPEPREDK
CETDFYNVTWFKVMTAIINFYLPTLLMLWFYAKIYKAVRQHCQHRELINGSFPSFSDMKM
KPENLQVGTKKPGKESPWEVLKRKPKDTGGGPVLKPPSQEPKEVTSPGVFSQEKEEKDGE
LGKYYCFPLDTVQAQPEAEGSGRGYAAINQSQNQLEMGEQGLSMPGAKEALEDQILGDSQ
SFSRTDSDTPAEPALAKGKSRSESSTGLEYIKFTWKRLRSHSRQYVSGLHMNRERKAAKQ
LGFIMAAFIICWIPYFIFFMVIAFCESCCNQHVHMFTIWLGYINSTLNPLIYPLCNENFK
KTFKKILHIRS
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgacctgtcccaactcctcctgcgtcttcgaagacaagatgtgtgaggggaataagact
gcccctgccaacaatgcccagctgacgcccctggtggtggtcctgagcaccatctccttg
gtcacagtgggactcaacctgctagtcctgtacgctgtgcgcagcgagcggaaactacac
accgtggggaacctctacatcgtcagcctctcagtggccgatctgatcgtgggggtggtc
gtcatgcccatgaacatcctctacctcctcatgtctaggtggtccctggggcgtcctctc
tgcctcttctggctttccatggactatgtggccagcacggcatccattttcagcgtcttc
atcttgtgcattgaccgctaccgttctgtgcagcagcccctcaagtacctgcggtatcgt
accaagacccgagcatccatcaccatcctagccgcctggtttctctccttcctgtggatt
atccccattctgggctggcgtcacttccagccaaagaccccagagccccgggaggacaag
tgtgagacggacttctacaacgtcacgtggttcaaagtcatgaccgccatcatcaacttc
tacttgcccaccttgctcatgctctggttctatgccaagatctacaaggctgtgcgtcag
cactgccagcaccgggagctcatcaacgggtccttcccctccttctctgacatgaagatg
aagccggagaacctccaggtgggcactaagaaaccggggaaggagtccccctgggaggtt
ctgaaaaggaagccaaaagacaccgggggtggacctgtcttgaagccaccatctcaagag
ccaaaagaggtgacatctccaggtgtcttcagccaagagaaggaagagaaggatggagaa
ctgggcaaatactactgcttcccgcttgacactgtgcaggcgcagccggaggcagagggg
agtggcaggggctacgcagccatcaaccagagccagaaccagcttgagatgggtgagcag
ggcctgagcatgcctggggctaaggaggccttagaggatcagatcctaggtgacagccag
tccttctcccggacagactcggacacccccgcagagccggcactggcgaaaggcaagtcg
cgaagcgagtctagcacaggcctggagtacatcaagttcacttggaagaggctccgctcg
cattcgagacagtacgtgtctggcttgcacatgaaccgagagcggaaggccgccaagcag
ttgggttttatcatggcggccttcatcatctgctggattccttacttcatcttcttcatg
gtcattgccttctgtgagagctgctgcaaccagcatgtgcacatgttcaccatctggctg
ggctacatcaactccacgctgaaccccctcatctaccccttgtgcaatgagaacttcaag
aagaccttcaagaaaattctgcacattcgttcctag

DBGET integrated database retrieval system