KEGG   Bos taurus (cow): 281246Help
Entry
281246            CDS       T01008                                 

Gene name
IL10
Definition
(RefSeq) interleukin-10 precursor
  KO
K05443  interleukin 10
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04068  FoxO signaling pathway
bta04625  C-type lectin receptor signaling pathway
bta04630  Jak-STAT signaling pathway
bta04660  T cell receptor signaling pathway
bta04672  Intestinal immune network for IgA production
bta05133  Pertussis
bta05140  Leishmaniasis
bta05142  Chagas disease (American trypanosomiasis)
bta05143  African trypanosomiasis
bta05144  Malaria
bta05145  Toxoplasmosis
bta05146  Amoebiasis
bta05150  Staphylococcus aureus infection
bta05152  Tuberculosis
bta05310  Asthma
bta05320  Autoimmune thyroid disease
bta05321  Inflammatory bowel disease (IBD)
bta05322  Systemic lupus erythematosus
bta05330  Allograft rejection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    281246 (IL10)
   04068 FoxO signaling pathway
    281246 (IL10)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    281246 (IL10)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    281246 (IL10)
   04660 T cell receptor signaling pathway
    281246 (IL10)
   04672 Intestinal immune network for IgA production
    281246 (IL10)
 09160 Human Diseases
  09163 Immune diseases
   05310 Asthma
    281246 (IL10)
   05322 Systemic lupus erythematosus
    281246 (IL10)
   05320 Autoimmune thyroid disease
    281246 (IL10)
   05321 Inflammatory bowel disease (IBD)
    281246 (IL10)
   05330 Allograft rejection
    281246 (IL10)
  09171 Infectious diseases: Bacterial
   05133 Pertussis
    281246 (IL10)
   05150 Staphylococcus aureus infection
    281246 (IL10)
   05152 Tuberculosis
    281246 (IL10)
  09174 Infectious diseases: Parasitic
   05146 Amoebiasis
    281246 (IL10)
   05144 Malaria
    281246 (IL10)
   05145 Toxoplasmosis
    281246 (IL10)
   05140 Leishmaniasis
    281246 (IL10)
   05142 Chagas disease (American trypanosomiasis)
    281246 (IL10)
   05143 African trypanosomiasis
    281246 (IL10)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:bta04052]
    281246 (IL10)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    281246 (IL10)
Cytokines and growth factors [BR:bta04052]
 Cytokines
  Interleukins
   281246 (IL10)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate/Haparin
  Cytokines
   281246 (IL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IL10 IL22 TSA
Motif
Other DBs
NCBI-GeneID: 281246
NCBI-ProteinID: NP_776513
BGD-bta: BT19796
Ensembl: ENSBTAG00000006685
UniProt: P43480
Position
16
AA seq 178 aa AA seqDB search
MHSSALLCCLVFLAGVAASRDASTLSDSSCIHLPTSLPHMLRELRAAFGEAKTFFQMKDQ
LHSLLLTQSLLDDFKGYLGCQALSEMIQFYLEEVMPQAENHGPDIKEHVNSLGEKLKTLR
LRLRRCHRFLPCENKSKAVEKVKRVFSELQERGVYKAMSEFDIFINYIETYMTTKMQK
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcatagctcagcactactctgttgcctggtcttcctggctggggtggcagccagccga
gatgcgagcaccctgtctgacagcagctgtatccacttgccaaccagcctgccccacatg
ctgcgggagctccgagctgccttcggcgaggcgaagactttctttcaaatgaaggaccaa
ctgcacagcttactgttgacccagtctctgctggatgactttaagggttacctgggttgc
caagccttgtcggaaatgatccagttttacctggaagaggtgatgccacaggctgagaac
cacgggcctgacatcaaggagcacgtgaactcactgggggagaagctgaagaccctgcgg
ctgcggctgcggcgctgtcatcgctttctgccctgcgaaaacaagagcaaggcggtggag
aaggtgaagagagtcttcagtgagctccaagagaggggtgtctacaaagccatgagtgag
tttgacatcttcatcaactacatagaaacctacatgacaacgaagatgcaaaagtga

DBGET integrated database retrieval system