KEGG   Bos taurus (cow): 281275Help
Entry
281275            CDS       T01008                                 

Gene name
LDHB
Definition
(RefSeq) L-lactate dehydrogenase B chain isoform LDHB
  KO
K00016  L-lactate dehydrogenase [EC:1.1.1.27]
Organism
bta  Bos taurus (cow)
Pathway
bta00010  Glycolysis / Gluconeogenesis
bta00270  Cysteine and methionine metabolism
bta00620  Pyruvate metabolism
bta00640  Propanoate metabolism
bta01100  Metabolic pathways
bta04066  HIF-1 signaling pathway
bta04922  Glucagon signaling pathway
bta05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    281275 (LDHB)
   00620 Pyruvate metabolism
    281275 (LDHB)
   00640 Propanoate metabolism
    281275 (LDHB)
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    281275 (LDHB)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    281275 (LDHB)
 09150 Organismal Systems
  09152 Endocrine system
   04922 Glucagon signaling pathway
    281275 (LDHB)
 09160 Human Diseases
  09161 Cancer: overview
   05230 Central carbon metabolism in cancer
    281275 (LDHB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    281275 (LDHB)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.27  L-lactate dehydrogenase
     281275 (LDHB)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   281275 (LDHB)
  Exosomal proteins of breast milk
   281275 (LDHB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldh_1_N Ldh_1_C Glyco_hydro_4
Motif
Other DBs
NCBI-GeneID: 281275
NCBI-ProteinID: NP_776525
BGD-bta: BT14803
Ensembl: ENSBTAG00000019603
VGNC: 30824
UniProt: Q5E9B1
Position
5
AA seq 334 aa AA seqDB search
MATLKEKLIAPVAEEETRIPNNKITVVGVGQVGMACAISILGKSLTDELALVDVLEDKLK
GEMMDLQHGSLFLQTPKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKF
IIPQIVKYSPDCIIIVVSNPVDILTYVTWKLSGLPKHRVIGSGCNLDSARFRYLMAEKLG
IHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDSENWKEVHKMVVESAY
EVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG
LTSVINQKLKDEEVAQLKKSADTLWGIQKDLKDL
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atggcaactcttaaggaaaaattgattgcaccagttgcagaagaagagacaaggatccca
aacaataagatcactgtagtgggtgttggacaagttggtatggcatgtgccatcagcatt
ctgggaaagtctctgactgacgagcttgctcttgtggatgttttggaagataaactcaaa
ggagaaatgatggacctgcagcacgggagcttattccttcagacaccaaaaattgtggca
gacaaagattactctgtcactgccaattccaagattgtggtggtaactgcaggagttcgc
cagcaagaaggggagagtcgcctgaatttggtgcaaaggaacgttaacgtcttcaagttc
atcattcctcagatcgtcaagtacagtcctgactgcatcatcattgtggtttccaaccca
gtggatattctcacatatgttacctggaaactaagtggattacccaagcaccgtgtgatt
gggagtggatgtaacctggattctgctagatttcgctaccttatggctgaaaaacttggc
attcatcccagcagctgccacggatggattttgggggaacatggcgactcaagcgtggct
gtgtggagtggagtgaatgtggcaggcgtttctctccaggaactgaatccagaaatggga
acagacaatgatagtgaaaattggaaggaagtgcataagatggtggttgagagtgcctat
gaagtcatcaagctaaaaggatataccaactgggctattggattaagtgtggctgatctt
attgaatccatgttgaaaaatctatcgaggattcacccagtgtcaacaatggtgaagggc
atgtatggcattgagaatgaagtcttcctgagccttccgtgtatcctgaatgctcgaggg
ttaaccagtgttatcaaccagaagctgaaggatgaagaggttgctcaactcaagaaaagt
gcagacaccctctggggcatccaaaaggacctgaaggacctgtga

DBGET integrated database retrieval system