KEGG   Bos taurus (cow): 281293Help
Entry
281293            CDS       T01008                                 

Gene name
MAOA
Definition
(RefSeq) amine oxidase [flavin-containing] A
  KO
K00274  monoamine oxidase [EC:1.4.3.4]
Organism
bta  Bos taurus (cow)
Pathway
bta00260  Glycine, serine and threonine metabolism
bta00330  Arginine and proline metabolism
bta00340  Histidine metabolism
bta00350  Tyrosine metabolism
bta00360  Phenylalanine metabolism
bta00380  Tryptophan metabolism
bta00982  Drug metabolism - cytochrome P450
bta01100  Metabolic pathways
bta04726  Serotonergic synapse
bta04728  Dopaminergic synapse
bta05030  Cocaine addiction
bta05031  Amphetamine addiction
bta05034  Alcoholism
Module
bta_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    281293 (MAOA)
   00330 Arginine and proline metabolism
    281293 (MAOA)
   00340 Histidine metabolism
    281293 (MAOA)
   00350 Tyrosine metabolism
    281293 (MAOA)
   00360 Phenylalanine metabolism
    281293 (MAOA)
   00380 Tryptophan metabolism
    281293 (MAOA)
  09111 Xenobiotics biodegradation and metabolism
   00982 Drug metabolism - cytochrome P450
    281293 (MAOA)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    281293 (MAOA)
   04726 Serotonergic synapse
    281293 (MAOA)
 09160 Human Diseases
  09164 Substance dependence
   05030 Cocaine addiction
    281293 (MAOA)
   05031 Amphetamine addiction
    281293 (MAOA)
   05034 Alcoholism
    281293 (MAOA)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.4  monoamine oxidase
     281293 (MAOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 DAO Thi4 FAD_binding_2 Pyr_redox_2 FAD_binding_3 HI0933_like FAD_oxidored Pyr_redox Pyr_redox_3 AlaDh_PNT_C Lycopene_cycl GIDA NAD_binding_9 3HCDH_N Trp_halogenase
Motif
Other DBs
NCBI-GeneID: 281293
NCBI-ProteinID: NP_851357
BGD-bta: BT11923
Ensembl: ENSBTAG00000016206
VGNC: 31174
UniProt: P21398
Position
X
AA seq 527 aa AA seqDB search
MESLQKTSDAGQMFDVVVIGGGISGLSAAKLLAEHEVNVLVLEARERVGGRTYTVRNEHV
DYVDVGGAYVGPTQNRILRLSKQLGLETYKVNVNERLVHYVKGKTYPFRGAFPPVWNPIA
YLDYNNLWRTMDNMGKEIPADAPWEAPHAVEWDKMTMKDLIEKICWTKTARQFASLFVNI
NVTSEPHEVSALWFLWYVKQCGGTTRIFSITNGGQERKFVGGSGQVSERIMQLLGDRVKL
RSPVTYVDQSSENITVETLNRELYECRYVISAIPPTLTAKIHFRPELPSERNQLIQRLPM
GAVIKCMMYYKEAFWKKKDYCGCMIIEDEEAPISITLDDTKPDGSLPAIMGFILARKADR
LAKVHKDIRKRKICELYAKVLGSQEALHPVHYEEKNWCQEQYSGGCYTAYFPPGIMTQYG
RVIRQPVGRIYFAGTETATQWSGYMEGAVEAGERAAREVLNALGKLSAKDIWIQEPEAED
VPAVEITPSFWERNLPSVSGLLKIVGFSTSITALWFVMYRFRLLSRS
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atggagagtctgcagaagacgagtgacgcgggccagatgttcgacgtagtcgtgatagga
ggcggcatctcaggattatctgctgcgaaactcttagccgaacatgaagttaatgttttg
gttttagaagcccgggagagagttggaggaagaacatacacagtgaggaatgaacatgtt
gactacgtagatgttggcggtgcttatgtaggcccgacccagaataggatcttacggtta
tctaagcaactgggtttagaaacttacaaagtgaatgtaaacgagcgtcttgttcattat
gtcaagggaaaaacttatccatttcggggtgccttccctccagtatggaatcccattgct
tatctggattacaacaacctgtggcggaccatggataacatgggaaaagagattccagct
gatgcaccatgggaggccccacatgcagtggaatgggataagatgactatgaaagatctc
atcgaaaaaatctgctggacaaagactgctcggcagtttgcatctctctttgtgaatatc
aatgtgacctctgaaccccatgaggtgtctgccctgtggttcttgtggtacgtgaaacaa
tgtgggggcacaactcggatattctccattaccaacggtggccaggaacggaagtttgta
ggtggatctggtcaagtaagcgaacggataatgcaactcctaggggacagggtgaaactg
aggagccctgtcacctatgttgaccagtcaagtgaaaacatcaccgtagagaccctgaat
cgtgaactttatgagtgccggtatgtcattagtgccatcccaccaactttgactgccaag
atacactttagaccagagcttccatcagagcgaaaccagctgatacagcgtcttccaatg
ggggctgtcattaagtgcatgatgtattacaaggaggccttttggaagaaaaaggattac
tgtggctgtatgatcatcgaagatgaggaagctccaatttcaataacactggatgatacc
aagccagatggatcactgcctgctatcatgggcttcatcctcgctcgaaaagctgaccgc
ctcgctaaagtgcataaagatataaggaaaagaaaaatctgtgaactgtacgccaaagtg
ctaggatctcaagaagctttacatccagtgcactatgaagagaagaactggtgtcaggag
cagtactccggaggctgctacactgcctacttccccccggggatcatgactcaatacgga
agggttattcgccaacctgtaggcaggatttactttgctggcacggaaactgccacacaa
tggagcggttatatggaaggagcagtagaggctggtgaacgggcagctagagaggttttg
aatgctttggggaagctgtctgccaaagatatctggatccaagaacctgaagctgaagat
gttccagctgtagagatcacccccagcttctgggagagaaacctgccttccgtatcaggc
ctgctgaagattgttgggttttccacatcgataactgccctgtggtttgtgatgtacaga
ttcaggctgctaagccgatcctga

DBGET integrated database retrieval system