KEGG   Bos taurus (cow): 281296Help
Entry
281296            CDS       T01008                                 

Gene name
MAPT
Definition
(RefSeq) microtubule-associated protein tau
  KO
K04380  microtubule-associated protein tau
Organism
bta  Bos taurus (cow)
Pathway
bta04010  MAPK signaling pathway
bta05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    281296 (MAPT)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    281296 (MAPT)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    281296 (MAPT)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    281296 (MAPT)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bta04812]
    281296 (MAPT)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     281296 (MAPT)
Membrane trafficking [BR:bta04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    281296 (MAPT)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Microtubule-associated proteins (MAPs)
     281296 (MAPT)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin-binding Tmemb_cc2
Motif
Other DBs
NCBI-GeneID: 281296
NCBI-ProteinID: NP_776531
BGD-bta: BT14326
Ensembl: ENSBTAG00000017512
UniProt: P29172
Position
19
AA seq 448 aa AA seqDB search
MAEPRQEFDVMEDHAQGDYTLQDQEGDMDPGLKESPLQTPADDGSEEPGSETSDAKSTPT
AEDATAPLVDEGAPGEQAAAQAPAEIPEGTAAEEAGIGDTSNLEDQAAGHVTQARMVSKG
KDGTGPDDKKTKGADGKPGTKIATPRGAAPPGQKGQANATRIPAKTTPTPKTSPATMQVQ
KKPPPAGAKSERGESGKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPP
KSPSAAKSRLQAAPGPMPDLKNVKSKIGSTENLKHQPGGGKVQIINKKLDLSNVQSKCGS
KDNIKHVPGGGSVQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQVEVKSEKLDFKDRVQSK
IGSLDNITHVPGGGNKKIETHKLTFRENAKAKTDHGAEIVYKSPVVSGDTSPRHLSNVSS
TGSIDMVDSPQLATLADEVSASLAKQGL
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atggctgagccccgccaggagttcgacgtgatggaagatcatgctcagggggactacacc
ctgcaagaccaggagggtgacatggaccccggcctgaaagagtctcccctgcagaccccg
gccgatgatggatctgaggaaccaggctctgaaacctctgatgctaagagcactccgacg
gcggaagatgcgacagcacccttagtggatgagggagcccccggtgagcaggcggccgct
caggcccccgcggagatcccagaaggaaccgcagctgaagaagcaggcattggcgacacg
tccaacctggaagaccaagctgccggacacgtgacccaagctcgcatggtcagtaaaggc
aaagatgggactggacccgatgacaaaaaaaccaagggggcggatggtaagcctggaacg
aagattgccacaccccggggagcagcccctccaggccagaaaggccaggccaacgccacc
cggattccagcaaaaaccactcccaccccgaagacctcgccagcaaccatgcaagtgcag
aaaaaaccaccccctgcaggggcaaaatctgagagaggtgaatctgggaaatccggggac
cgcagcggctacagcagccccggctccccaggcactccgggcagccgctcccgcacaccc
tccctgccgaccccgcccacccgggagcccaagaaggtggcggtggtccgcactcccccc
aagtcgccgtctgcagccaagagccgcctgcaggccgctcccgggcccatgccagacctg
aagaacgtcaagtccaaaatcggctccacggaaaacctgaagcaccagccaggaggtggc
aaggtgcagataattaataagaagctggatcttagcaacgtccagtccaagtgtggctca
aaggataatatcaaacacgtgccaggaggcggcagtgtgcaaatagtctacaaaccagtg
gatctgagcaaggtgacctccaagtgtggctcattaggcaacatccatcataagccagga
ggtggccaagtggaagtgaaatctgagaagctggacttcaaggatagagtccagtcgaag
attgggtccctggacaacatcacacacgtccctggcggagggaataaaaagatcgaaacc
cacaagctgaccttccgcgagaacgccaaagccaagaccgaccacggggcggagatcgtg
tacaagtcaccggtggtgtcgggggacacttccccccggcacctcagcaacgtgtcctcc
accggcagcatcgacatggtggactcgccgcagctcgccaccctcgctgacgaggtgtcc
gcctccctggccaagcagggtttgtga

DBGET integrated database retrieval system