KEGG   Bos taurus (cow): 281312Help
Entry
281312            CDS       T01008                                 

Gene name
MSRA
Definition
(RefSeq) mitochondrial peptide methionine sulfoxide reductase
  KO
K07304  peptide-methionine (S)-S-oxide reductase [EC:1.8.4.11]
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    281312 (MSRA)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.4  With a disulfide as acceptor
    1.8.4.11  peptide-methionine (S)-S-oxide reductase
     281312 (MSRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMSR
Motif
Other DBs
NCBI-GeneID: 281312
NCBI-ProteinID: NP_776539
Ensembl: ENSBTAG00000021632
VGNC: 31705
UniProt: P54149
Structure
PDB: 

Position
8
AA seq 233 aa AA seqDB search
MLSVTRRALQLFHSLFPIPRMGDSAAKIVSPQEALPGRKEPLVVAAKHHVNGNRTVEPFP
EGTQMAVFGMGCFWGAERKFWTLKGVYSTQVGFAGGYTPNPTYKEVCSGKTGHAEVVRVV
FQPEHISFEELLKVFWENHDPTQGMRQGNDHGSQYRSAIYPTSAEHVGAALKSKEDYQKV
LSEHGFGLITTDIREGQTFYYAEDYHQQYLSKDPDGYCGLGGTGVSCPLGIKK
NT seq 702 nt NT seq  +upstreamnt  +downstreamnt
atgctctcggtcaccaggagggccctccagctctttcacagcctcttccccatcccgaga
atgggtgactccgccgccaagatcgtcagtccccaggaagccttgccgggccggaaggag
cccctcgtcgtagcggccaaacatcatgtcaatggcaacagaacagttgaacctttccca
gaggggacacagatggctgtatttggaatgggctgtttctggggagctgaaaggaaattc
tggaccctgaaaggtgtatattcaactcaagttggttttgcaggaggctatactcccaat
cctacttataaagaagtctgctcaggaaaaactggccacgcagaagtagtccgggtggtg
ttccagccagaacacatcagctttgaggaactgctcaaggtcttctgggagaatcatgac
ccgacccaaggcatgcgccaaggcaatgaccacggctctcagtaccgctcagccatctac
ccgacctctgccgagcacgtgggggcagccctgaagtccaaggaggactaccagaaggtt
ctgtcggagcatggttttgggctgatcaccacggacatccgggagggacaaaccttttac
tatgcggaagattaccaccagcagtacctgagcaaggaccccgacgggtactgcggcctc
gggggcaccggagtgtcttgtcccctgggtattaaaaagtaa

DBGET integrated database retrieval system