KEGG   Bos taurus (cow): 281368Help
Entry
281368            CDS       T01008                                 

Gene name
OLR1
Definition
(RefSeq) oxidized low-density lipoprotein receptor 1
  KO
K08763  oxidised low-density lipoprotein receptor 1
Organism
bta  Bos taurus (cow)
Pathway
bta03320  PPAR signaling pathway
bta04145  Phagosome
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    281368 (OLR1)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    281368 (OLR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    281368 (OLR1)
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:bta04054]
    281368 (OLR1)
   04091 Lectins [BR:bta04091]
    281368 (OLR1)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Phagocytosis
   Scavenger receptors
    281368 (OLR1)
Pattern recognition receptors [BR:bta04054]
 Membrane-bound pattern recognition receptors
  C-type lectin receptors
   281368 (OLR1)
Lectins [BR:bta04091]
 C-Type lectins
  Gropu 5: NK-cell receptors
   281368 (OLR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Lectin_C UL45 Ly49 UPF0242 FAM176 DUF4446 HemX Vpu DUF3416 Tmemb_9
Motif
Other DBs
NCBI-GeneID: 281368
NCBI-ProteinID: NP_776557
BGD-bta: BT10171
Ensembl: ENSBTAG00000004547
VGNC: 32427
UniProt: P79391
Position
5
AA seq 270 aa AA seqDB search
MTVDDPKGMKDQLDQKPNGKTAKGFVSSWRWYPAAVTLGVLCLGLLVTVILLILQLSQVS
DLIKKQQANITHQEDILEGQILAQRRSEKSAQESQKELKEMIETLAHKLDEKSKKLMELH
RQNLNLQEVLKEAANYSGPCPQDWLWHEENCYQFSSGSFNWEKSQENCLSLDAHLLKINS
TDELEFIQQMIAHSSFPFWMGLSMRKPNYSWLWEDGTPLTPHLFRIQGAVSRMYPSGTCA
YIQRGTVFAENCILTAFSICQKKANLLRAQ
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgactgttgatgaccccaagggtatgaaagatcaacttgatcagaagccaaatggcaag
acagcaaaaggttttgtttcctcttggaggtggtaccctgctgctgtgactctaggggtc
ctttgtctgggattactggtgactgttatattgttgatactgcaattatcccaggtctct
gatctcataaagaaacagcaagcaaatattactcaccaggaagatatcctggagggacag
attttagcccagcgccgatcagaaaaatctgcccaggagtcacagaaggaactcaaagaa
atgatagaaacccttgcccacaagctggatgagaaatccaagaaactaatggaacttcac
cgccagaacctgaatctccaagaagttctgaaagaggcagcaaactattcaggtccttgt
ccccaagactggctctggcatgaagaaaactgttaccaattttcctctggctcttttaat
tgggaaaaaagccaggagaactgcttgtctttggatgcccacttgctgaagattaatagc
acagatgaactggaattcatccagcaaatgattgcccattccagtttccccttctggatg
gggttgtcaatgaggaaacccaattactcgtggctttgggaagatggtactcctttgacg
ccccacttgtttagaattcagggagctgtttcccgtatgtatccttcagggacctgtgca
tatattcaaaggggaactgtttttgctgaaaactgcattttaactgcattcagtatatgt
caaaagaaggcgaatctattgagagcacagtga

DBGET integrated database retrieval system