KEGG   Bos taurus (cow): 281414Help
Entry
281414            CDS       T01008                                 

Gene name
PNOC
Definition
(RefSeq) prepronociceptin precursor
Organism
bta  Bos taurus (cow)
SSDB OrthologParalogGFIT
Motif
Pfam: Opiods_neuropep
Motif
Other DBs
NCBI-GeneID: 281414
NCBI-ProteinID: NP_776575
BGD-bta: BT11210
Ensembl: ENSBTAG00000000534
VGNC: 33089
UniProt: O62647
Position
8
AA seq 176 aa AA seqDB search
MKILFCDLLLLSLFSSVSSSCQKDCLVCREKLRPTLDSFSLEMCILECEEKAFTSPLWTP
CTKVMARGSWQLSPADPDHVAAALDQPRASEMQHLKRMPRVRSLFQRQKRTEPGLEEVGE
IEQKQLQKRFGGFTGARKSARKLANQKRFSEFMRQYLVLSMQSSQRRRTLHQNGNA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcctgttttgtgacctcctgctgctcagcctcttctccagcgtgtccagcagc
tgtcagaaggactgtctggtctgcagagagaagctccgccccactcttgacagcttcagc
ctcgagatgtgcatccttgagtgtgaagagaaggccttcaccagccctctctggactcca
tgcaccaaggtcatggccaggggctcctggcagctcagccctgctgacccagaccacgtg
gcagctgctctggaccagcccagagcctctgagatgcagcatctgaagcgaatgccccgg
gtcaggagcctctttcaaaggcagaagaggacagagcccggcctggaggaggtgggggag
attgagcagaaacagctgcagaagcggttcgggggcttcaccggggcccggaagtcggcc
cggaagttggccaaccagaagcggttcagtgagtttatgcggcagtacctggtcctgagc
atgcagtccagccagcgtcggcgcaccctgcaccagaatggtaatgcgtag

DBGET integrated database retrieval system