KEGG   Bos taurus (cow): 281422Help
Entry
281422            CDS       T01008                                 

Gene name
PRLR
Definition
(RefSeq) prolactin receptor long form precursor
  KO
K05081  prolactin receptor
Organism
bta  Bos taurus (cow)
Pathway
bta04060  Cytokine-cytokine receptor interaction
bta04080  Neuroactive ligand-receptor interaction
bta04151  PI3K-Akt signaling pathway
bta04630  Jak-STAT signaling pathway
bta04917  Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    281422 (PRLR)
   04151 PI3K-Akt signaling pathway
    281422 (PRLR)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    281422 (PRLR)
   04060 Cytokine-cytokine receptor interaction
    281422 (PRLR)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    281422 (PRLR)
Cytokine receptors [BR:bta04050]
 Interleukin receptor families
  Prolactin receptor family
   281422 (PRLR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EpoR_lig-bind fn3 IL6Ra-bind Tissue_fac
Motif
Other DBs
NCBI-GeneID: 281422
NCBI-ProteinID: NP_001034815
BGD-bta: BT12471
Ensembl: ENSBTAG00000025035
VGNC: 33346
UniProt: Q28172
Position
20
AA seq 581 aa AA seqDB search
MKENAASRVVFILLLFLSVSLLNGQSPPEKPKLVKCRSPGKETFTCWWEPGADGGLPTNY
TLTYHKEGETLIHECPDYKTGGPNSCYFSKKHTSIWKMYVITVNAINQMGISSSDPLYVH
VTYIVEPEPPANLTLELKHPEDRKPYLWIKWSPPTMTDVKSGWFIIQYEIRLKPEKATDW
ETHFTLKQTQLKIFNLYPGQKYLVQIRCKPDHGYWSEWSPESSIQIPNDFPVKDTSMWIF
VAILSAVICLIMVWAVALKGYSMVTCILPPVPGPKIKGFDVHLLEKGKSEELLRALESQD
FPPTSDCEDLLMEFIEVDDCEDQQLMPRPSKEHTEQGVKPMHLDLDSDSGRGSCDSPSLL
SEKCDEPQAHPSKFHTPEGPEKLENPETNLTCLQAPQSTSVEGKIPYFLANGPKSSTWPF
PQPPSLYSPRYSYHNIADVCELALGMAGTTATSLDQTDQHALKASKTIETGREGKATKQR
ESEGCSSKPDQDTVWPRPQDKTPLISAKPLEYVEIHKVSQDGVLALFPKQNEKFGAPEAS
KEYSKVSRVTDSNILVLVPDPQAQNLTLLEEPAKKAPPALP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaatgcagcatctagagtggttttcattttgctactttttctcagtgtcagc
cttctgaatggacagtcacctcctgaaaaacccaagctcgttaaatgtcggtctcctgga
aaggaaacattcacctgctggtgggagcctggggcagatggaggacttcctaccaattac
acgctgacttaccacaaggaaggagaaacactcatccatgaatgtccagactacaaaacc
gggggccccaactcctgctactttagcaagaagcacacctccatatggaagatgtacgtc
atcacagtaaacgccatcaaccagatgggaatcagttcctcggatccactttatgtgcac
gtgacttacatagttgaaccagagcctcctgcaaacctgactttggaattaaaacatcca
gaagatagaaaaccatatctatggataaaatggtctccacccaccatgactgatgtaaaa
tctggttggttcattatccagtacgaaattcgattaaaacctgagaaagcaactgattgg
gagactcattttactctgaagcaaactcagcttaagattttcaacttatatccaggacaa
aaataccttgtgcagattcgctgcaagccagaccatggatactggagtgagtggagccca
gagagctccatccagatacctaatgacttcccagtgaaggacacaagcatgtggatcttt
gtggccatcctttctgctgtcatctgtttgattatggtctgggcagtggctttgaagggc
tatagcatggtgacctgcatcctcccaccagttccagggccaaaaataaaaggatttgat
gttcatctgctggagaagggcaagtccgaagaacttctgcgagctctggaaagccaagac
ttcccccccacttctgactgcgaggacttgctgatggagttcatagaggtagatgactgt
gaggaccagcagctgatgccacgcccctccaaagaacacacggagcaaggcgtgaagccc
atgcacctggatcttgacagtgactctggccggggcagctgcgacagcccttcgctcttg
tctgaaaagtgtgatgaacctcaggcccatccctccaagttccatactcccgagggccct
gagaagctggagaatccggaaacaaaccttacatgtctccaggcccctcagagcacaagc
gtggaaggcaaaatcccctattttctggccaatggacccaaatcttccacatggcctttc
ccgcagccccccagcctatacagccccagatattcttaccacaacattgctgacgtgtgt
gagctggccctgggcatggccggcaccacagccacttcgctggaccaaacagaccaacat
gctttaaaagcctcaaaaaccattgaaactggcagggaaggaaaggcaaccaagcagagg
gagtcagaaggctgcagttccaagcctgaccaagacacggtgtggccacgaccccaagac
aaaacccccttgatctctgctaaacccttggaatacgtggagatccacaaggtcagccaa
gatggagtgctggctctgttcccaaaacaaaacgagaagtttggcgcccctgaagccagc
aaggagtactcaaaggtgtcccgggtgacagatagcaacatcctggtattggtgccggat
ccgcaagcgcaaaacctgactctgttagaagaaccagccaagaaggccccgccagccctg
ccatag

DBGET integrated database retrieval system