KEGG   Bos taurus (cow): 281448
Entry
281448            CDS       T01008                                 

Gene name
RDH5
Definition
(RefSeq) 11-cis retinol dehydrogenase precursor
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
bta  Bos taurus (cow)
Pathway
bta00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    281448 (RDH5)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     281448 (RDH5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10
Other DBs
NCBI-GeneID: 281448
NCBI-ProteinID: NP_776591
BGD-bta: BT19116
Ensembl: ENSBTAG00000011927
VGNC: 33843
UniProt: Q27979
Position
5
AA seq 318 aa
MWLPLLLGVLLWAALWLLRDRQCLPASDAFIFITGCDSGFGRLLALRLDQRGFRVLASCL
TPSGAEDLQRVASSRLHTTLLDVTDPQSIRQAVKWVETHVGEAGLFGLVNNAGVAGIIGP
TPWQTREDFQRVLNVNTLGPIGVTLALLPLLLQARGRVINITSVLGRLAANGGGYCVSKF
GLEAFSDSLRRDVAPFGVRVSIVEPGFFRTPVTNLETLEDTLQACWARLPPATQALYGEA
FLTKYLRVQQRIMNMICDPDLAKVSRCLEHALTARHPRTRYSPGWDAKLLWLPASYLPAR
LVDAVLAWVLPKPAQTVY
NT seq 957 nt   +upstreamnt  +downstreamnt
atgtggctgcctctgctgctgggtgtcttgctctgggcagcactgtggttgctcagggac
cggcagtgcctgccagccagcgatgcctttatcttcatcaccggctgtgactcgggcttt
gggcggctccttgctctgaggctggaccagagaggcttccgagtactagccagctgcctg
acaccctcgggggcggaggacctccagcgggtcgcctcctcccgcctccacaccaccctg
ctggatgtcacagatccccagagcatccggcaggcagtcaagtgggtggaaacgcatgtt
ggggaagcagggctttttggtctggtgaataatgctggtgtggctggcatcattggtccc
accccatggcagacgcgggaggacttccagcgggtgctgaatgtgaacacgctgggtccc
atcggggtcaccctcgccctgctgcccctgctgctgcaggcccggggccgagtgatcaac
atcaccagtgtccttggccgtctggcagccaatggagggggctactgcgtctccaagttt
ggcctggaggccttctctgacagcctgaggcgagatgtggctccttttggggtacgggtc
tctatcgtggaacctggcttcttccgaacccctgtgacaaacctggaaactttggaggac
accctgcaggcctgctgggcacggctgcctccagccacacaggccctctatggggaggcc
ttcctcaccaaatacctgagagtgcagcaacgtatcatgaacatgatctgtgatccggac
ctggccaaggtgagcaggtgcctggagcatgccctaactgcccgtcaccccagaacccgc
tacagcccaggctgggatgccaagctgctctggttgccagcctcctacttgccagccagg
ctggtggatgctgtgctcgcctgggtccttcccaagcctgcccagacagtctactaa

DBGET integrated database retrieval system