KEGG   Bos taurus (cow): 281465
Entry
281465            CDS       T01008                                 

Gene name
ROM1
Definition
(RefSeq) rod outer segment membrane protein 1
  KO
K17344  rod outer segment membrane protein 1
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99992 Structural proteins
    281465 (ROM1)
SSDB
Motif
Pfam: Tetraspanin
Other DBs
NCBI-GeneID: 281465
NCBI-ProteinID: NP_776599
BGD-bta: BT28975
Ensembl: ENSBTAG00000001188
VGNC: 34084
UniProt: P52205
Position
29
AA seq 351 aa
MAPVLPLVLPLQPRIRLAQGLWLLSWLLVLVGGLTLLCSGHLLVQLWHLGTFLAPSCPFS
ALPQVALAASAVALGTGLVGSGASRASLDAEQYPPWRGVLGPLLVAGTAGGGGLLVLALG
LALALPGTLDTGLEEGLGSALVHYKDTEVPGRCQAKRLLDELQLRHHCCGRHGYKDWFGI
QWVSNRYLDPNDPDVVDRIQSNVEGLYLIDGVPFSCCNPHSPRPCLQSQLSDPHAHPLFD
PRQPNLNLWSQGCHEVLLGHLQGLASTLGNMLAVTFLLQTLVLLGLRYLQTALEGLGGVI
DGEGEAQGYLFPAGLKDMLKTAWLQGAGPHRPAPGETPPEEKPPKECLPEA
NT seq 1056 nt   +upstreamnt  +downstreamnt
atggcgccggtgctgcccctggtcctgcccctccagccccgcatccgtctggcgcagggg
ctctggcttctctcctggctgctcgtgctggtcggtggcctcaccctcctctgtagcggg
cacctcctggtccagctgtggcaccttggtaccttcttggctccctcttgcccgttctct
gccctgccccaggttgccttggcggccagtgcagtggctctgggcacaggactggtgggt
tcaggagctagccgggccagtctggatgcagaacaataccctccctggcgaggggtccta
ggcccgctgctggtggctggcacagcggggggcgggggtctcctggtccttgccctggga
ctagccctggctttacctgggactctggacacgggcctggaggagggcctggggtctgcc
ttggttcactacaaggacacagaggtgcccggacgctgtcaagccaaacggctgttggat
gagttgcagctgaggcaccactgctgtggccgtcatggctacaaggattggtttggaatc
cagtgggtcagcaaccgttacctggatcccaatgaccccgacgtggttgaccggatccag
agcaatgtggaaggcctgtatctgattgatggggtccctttctcctgctgtaatccccac
tcacccagaccttgcctgcaaagccagctctcagacccccacgcccaccccctctttgat
ccccgacagcccaacctcaacctctggtcccaaggatgccacgaggtgttactggggcac
ttgcaggggctggcaagcacactgggcaacatgctggctgttaccttcctgctgcagact
ctggtacttctgggcctgcggtacctgcagacagcactggaggggctcggaggagtcatt
gatggggagggagaggcccagggctacctctttcctgctgggctgaaagacatgctgaaa
acagcctggctacagggagcagggccccataggccagcacctggggagaccccaccagaa
gagaaacctcccaaggagtgtctgcctgaggcctag

DBGET integrated database retrieval system