KEGG   Bos taurus (cow): 281486Help
Entry
281486            CDS       T01008                                 

Gene name
SELP
Definition
(RefSeq) P-selectin precursor
  KO
K06496  selectin, platelet
Organism
bta  Bos taurus (cow)
Pathway
bta04514  Cell adhesion molecules (CAMs)
bta05144  Malaria
bta05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    281486 (SELP)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    281486 (SELP)
  09174 Infectious disease: parasitic
   05144 Malaria
    281486 (SELP)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bta04515]
    281486 (SELP)
   04090 CD molecules [BR:bta04090]
    281486 (SELP)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    281486 (SELP)
   04091 Lectins [BR:bta04091]
    281486 (SELP)
Cell adhesion molecules [BR:bta04515]
 Selectins
  Selectin family
   281486 (SELP)
CD molecules [BR:bta04090]
 Proteins
  281486 (SELP)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   281486 (SELP)
Lectins [BR:bta04091]
 C-Type lectins
  Group 4: Selectins
   281486 (SELP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sushi Lectin_C EGF EGF_2 EGF_3 Plasmod_Pvs28
Motif
Other DBs
NCBI-GeneID: 281486
NCBI-ProteinID: NP_776608
BGD-bta: BT18902
Ensembl: ENSBTAG00000020755
VGNC: 34424
UniProt: P42201
Position
16
AA seq 646 aa AA seqDB search
MASCPKAIWNWRFQRAVFRTVQLLCFSVLIFEVINQKEVSAWTYHYSNKTYSWNYSRAFC
QKYYTDLVAIQNKNEIAYLNETIPYYNSYYWIGIRKINNKWTWVGTKKTLTEEAENWADN
EPNNKRNNQDCVEIYIKSLSAPGKWNDEPCWKRKRALCYRASCQDMSCSKQGECIETIGN
YTCSCYPGFYGPECEYVRECGEFDLPQHVHMNCSHPLGNFSFNSHCSFHCAEGYALNGPS
ELECLASGIWTNSPPQCVAVQCPALKSPEQGSMSCVQSAEAFQHQSSCSFSCEEGFALVG
PEVVHCTALGVWTAPTPVCKALQCQDLPTSTKARVNCSHPFGDFRYQSTCSFTCDEGSFL
VGASVLQCLDTGNWDAPFPECQAVTCAALPNPQNGEKTCVQPLGGSSYESTCWFTCHEGF
SLSGPERLDCTPSGHWTGSPPTCEEVDTVSAPAPGVQCPTLIAPKQGTMSCQHHVRNFGL
NTTCHFGCKAGFTLLGDSALQCRPSRQWTAAAPTCRAVKCAKLPVTEPIVMNCSNPWGNF
SYGSTCSFHCPEGQLLNGSERTVCQENGQWSTTMPTCQAGPLTIQETLTYVGGAAAGTTG
LVTGSILLALLRRRCRQKDDGKSPLNPQSHLGTYGVFTNAAFDPSP
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atggccagctgcccaaaagccatctggaactggagatttcagagagcggtcttcagaact
gtccaactcctttgcttcagtgtcctgatcttcgaggtaataaaccagaaagaagtatca
gcatggacctaccactacagcaataaaacatattcatggaattattcccgggcattctgt
cagaagtactacacggatttagtggccatccagaataaaaacgagattgcttatctcaac
gagaccataccttactacaactcttactactggattggtattcgaaagatcaacaataaa
tggacctgggtgggaaccaaaaagactctcactgaggaggctgagaactgggctgacaat
gagcctaacaacaagaggaacaaccaggactgtgtggagatctacatcaagagtctgtca
gcccctggcaagtggaatgatgagccctgctggaaaagaaagcgagcactctgctataga
gcctcctgccaggacatgtcctgcagcaagcaaggagagtgcattgagaccattgggaac
tacacctgctcctgttaccctggattctatggaccggagtgtgaatatgtcagagagtgc
ggcgagtttgatcttcctcaacatgtgcacatgaactgcagccaccctcttggaaacttc
tctttcaactcacactgcagcttccactgcgctgaaggctatgcgctgaacggacccagt
gagctggagtgtttggcttctggaatctggacgaattcacccccacagtgtgtagctgtc
cagtgcccggctctgaagtctccggagcaaggaagcatgagctgtgtccagtccgcggaa
gcattccagcaccagtccagctgcagcttcagctgcgaagagggattcgcattagttggg
ccagaggtagtgcactgcacagccttgggggtgtggacagccccaactccggtgtgtaaa
gcattgcagtgccaggatcttccgacctcaactaaggcccgggtgaactgctcgcatccc
tttggcgactttaggtaccagtcgacctgtagcttcacctgcgatgaaggttcattcctg
gtgggagcaagtgtgctgcaatgcctggatacggggaactgggatgctccttttccagaa
tgccaagctgttacctgcgcagctctgccaaaccctcagaatggagaaaagacttgtgtc
caacctcttggaggttccagttatgagtccacatgctggttcacatgtcatgagggattc
tctttatccggaccagaaagactggactgtactccatctggacactggacgggctcccca
ccaacgtgtgaagaagtggacacagtatcagctcctgctccaggggtgcaatgcccaacc
ctcatcgctccgaagcagggaacaatgtcctgtcagcaccatgtgaggaactttggtttg
aataccacttgccactttggatgcaaagctggattcacactcctgggagatagtgctctc
cagtgcagaccttccagacaatggacggcagcagctcccacgtgcagagctgtcaaatgc
gccaagctacctgttactgagccaatagtgatgaactgctccaacccttggggaaatttc
agctatggatcaacctgcagcttccattgcccagagggtcaattacttaatggctcagaa
agaacagtatgccaagagaatggtcagtggtcaacgaccatgccaacctgtcaagcaggg
ccactgactatccaggaaaccctgacttatgttggtggagcagcagctggtacaacaggc
ttagtgacgggttcaattctcctggctctgctaagaaggcgttgcagacaaaaagatgat
ggaaaaagccccttgaaccctcaaagccacctaggaacatacggagtttttacaaatgct
gcgtttgacccaagcccttaa

DBGET integrated database retrieval system