KEGG   Bos taurus (cow): 281504Help
Entry
281504            CDS       T01008                                 

Gene name
SRPRA
Definition
(RefSeq) signal recognition particle receptor subunit alpha
  KO
K13431  signal recognition particle receptor subunit alpha
Organism
bta  Bos taurus (cow)
Pathway
bta03060  Protein export
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    281504 (SRPRA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:bta02044]
    281504 (SRPRA)
Secretion system [BR:bta02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   281504 (SRPRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SRP-alpha_N SRP54 SRP54_N ArgK CbiA AAA_16 AAA_30 PfkB Fer4_NifH
Motif
Other DBs
NCBI-GeneID: 281504
NCBI-ProteinID: NP_001068590
BGD-bta: BT10484
Ensembl: ENSBTAG00000014105
UniProt: Q3MHE8
Position
29
AA seq 639 aa AA seqDB search
MLDFFTIFSKGGLVLWCFQGVSDSCTGPVNALIRSVLLQERGGNNSFTHEALTLKYKLDN
QFELVFVVGFQKILTLTYVDKLIDDVHRLFRDKYRTEIQQQSALSLLNGTFDFQNDFLRL
LREAEESSKIRAPTTMKKFEDSEKAKKPVRSMIETRGEKPKEKAKNNKKNKGAKKEGSDG
PLATSKAAPAEKSGLPVGPENGEELSKEEQIRRKREEFIQKHGRGMEKSSKSSKSDAPKE
KGKKAPRVWALGGSANKEVLDYSTPTTNGAPEAAPPEDINLIRGTGPGRQLQDLDCSSSD
DEGAAQNSTKPSATKGTLGGMFGMLKGLVGSKSLTREDMESVLDKMRDHLIAKNVAADIA
VQLCESVANKLEGKVMGTFSTVTSTVKQALQESLVQILQPQRRVDMLRDIMDAQRHQRPY
VVTFCGVNGVGKSTNLAKISFWLLENGFSVLIAACDTFRAGAVEQLRTHTRRLSALHPPE
KHGGRTMVQLFEKGYGKDAAGIAMEAIAFARNQGFDVVLVDTAGRMQDNAPLMTALAKLI
TVNTPDLVLFVGEALVGNEAVDQLVKFNRALADHSMAQTPRLIDGIVLTKFDTIDDKVGA
AISMTYITSKPIVFVGTGQTYCDLRSLNAKAVVAALMKA
NT seq 1920 nt NT seq  +upstreamnt  +downstreamnt
atgctcgacttcttcaccattttttccaaaggcgggctcgttctctggtgctttcagggc
gtgagcgactcatgcaccgggcctgttaacgcgttaattcgttccgtgctgctgcaggag
agaggaggtaacaactccttcacccatgaggcactcactctcaagtataaactggacaac
cagtttgagttggtgtttgtggtaggttttcagaagatcctaacactgacgtatgtggac
aagttgatagacgacgttcaccggctgtttcgagacaagtaccgcactgagatccaacag
cagagtgccttaagtctattgaatggcactttcgatttccagaatgactttctgcggctc
cttcgtgaagcagaggagagcagtaagatccgtgctcccactaccatgaagaaatttgaa
gattctgagaaggcgaagaaacccgtgagatccatgattgagacacggggtgaaaagcct
aaggaaaaagccaagaataacaaaaaaaacaagggggccaaaaaggaaggttctgatggc
cctctggctactagcaaagcagcccctgcagaaaagtcaggtctcccagtaggacctgag
aacggggaggaactttccaaagaggagcagatccgcaggaagcgggaagagttcattcag
aagcatgggaggggtatggagaagtccagcaagtccagtaagtcagatgctcccaaggag
aaaggcaaaaaggcaccccgggtgtgggcactgggaggctctgctaacaaggaagttctg
gactacagcactcccaccaccaacggagccccggaagcggccccgcctgaggacatcaac
ttgattcgagggactgggcctgggaggcagcttcaggatctggactgcagcagctcagat
gatgaaggagctgctcagaactccaccaaacctagtgctaccaaggggactctgggtggc
atgtttgggatgctcaagggccttgtgggttccaagagcttgactcgtgaagacatggag
tctgtgctggacaagatgcgtgatcatctcattgctaagaatgtggcagcagacattgca
gtccagctctgtgaatccgtggccaacaagttggaagggaaggtgatggggacgttcagc
acggtgacttccacggtcaagcaagctctgcaggagtccttggtgcagattctacagccg
cagcgccgcgtagacatgctccgggacatcatggatgcccagcgtcatcagcgcccgtac
gtggtcactttctgtggtgtgaacggcgtggggaagtctaccaaccttgccaagatctcc
ttctggctgttagagaacggcttcagtgtcctcatcgctgcctgcgacacatttcgtgcc
ggggctgtggaacagctgcggacgcacacccggcgtctgagcgccctgcacccccccgag
aagcacggcggccggaccatggtgcagctgttcgagaagggctacggcaaggatgctgct
ggcattgccatggaggccattgcctttgcacgtaaccaaggctttgatgtggtgctggtg
gacacagctggccgcatgcaagacaacgctcccctgatgactgccctggccaagctcatc
actgtcaacacacctgacctggtgctgtttgtgggggaggccttagtaggcaacgaggcc
gtggaccagctggtcaagttcaacagagccttggctgaccattctatggcccagacaccc
cggcttattgatggcattgtccttaccaaatttgataccattgatgacaaggtgggagct
gcgatttctatgacctacatcacaagcaaacccatcgtctttgtgggcactggccagacc
tactgtgacctacgcagtctaaacgccaaggctgtggtggctgccctcatgaaggcctaa

DBGET integrated database retrieval system