KEGG   Bos taurus (cow): 281555Help
Entry
281555            CDS       T01008                                 

Gene name
TUBB2B
Definition
(RefSeq) tubulin beta-2B chain
  KO
K07375  tubulin beta
Organism
bta  Bos taurus (cow)
Pathway
bta04145  Phagosome
bta04540  Gap junction
bta05010  Alzheimer disease
bta05012  Parkinson disease
bta05016  Huntington disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    281555 (TUBB2B)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    281555 (TUBB2B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    281555 (TUBB2B)
   05012 Parkinson disease
    281555 (TUBB2B)
   05016 Huntington disease
    281555 (TUBB2B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:bta03036]
    281555 (TUBB2B)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:bta04812]
    281555 (TUBB2B)
   04147 Exosome [BR:bta04147]
    281555 (TUBB2B)
Chromosome and associated proteins [BR:bta03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Microtubules and associated factors
    Other tubulins
     281555 (TUBB2B)
Cytoskeleton proteins [BR:bta04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulins
    281555 (TUBB2B)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   281555 (TUBB2B)
  Exosomal proteins of colorectal cancer cells
   281555 (TUBB2B)
  Exosomal proteins of bladder cancer cells
   281555 (TUBB2B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tubulin Tubulin_C Misat_Tub_SegII Tubulin_3 Tubulin_2
Motif
Other DBs
NCBI-GeneID: 281555
NCBI-ProteinID: NP_001003900
Ensembl: ENSBTAG00000004093
UniProt: Q6B856
Structure
PDB: 

Position
23
AA seq 445 aa AA seqDB search
MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEATGNKYV
PRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVV
RKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVV
EPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCL
RFPGQLNADLRKLAVNMVPFPRLHFFMPGFAPLTSRGSQQYRALTVPELTQQMFDSKNMM
AACDPRHGRYLTVAAIFRGRMSMKEVDEQMLNVQNKNSSYFVEWIPNNVKTAVCDIPPRG
LKMSATFIGNSTAIQELFKRISEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVS
EYQQYQDATADEQGEFEEEEGEDEA
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgagatcgtgcacatccaggcgggccagtgcggcaaccagattggcgccaagttt
tgggaagtcatcagtgatgagcatggcatcgaccccactggcagttaccacggagacagt
gacttgcagctggagagaatcaatgtgtactacaatgaggccaccggtaacaagtatgtg
cctcgggccatcctggtggacctggagccgggcaccatggactccgtcaggtctggaccc
ttcggccagatcttcaggcctgacaacttcgtgtttggccagagtggtgccgggaacaac
tgggccaagggccactacacagagggcgccgagctggtggactcggtcctggacgtggtc
aggaaggagtccgagagctgtgactgtctgcagggcttccagctgacccattcgctgggg
ggcggcacggggtctgggatggggacccttctcattagtaagatccgcgaggagtacccc
gaccgcatcatgaacacctttagcgtcatgccctcgcccaaggtgtccgacacggtggtg
gagccctacaacgccaccctgtccgtgcaccagctggtggagaacacggatgagacctac
tcgattgacaacgaggcgctgtatgacatctgcttccgcaccctgaaactgaccaccccc
acctacggggacctcaaccacctggtgtcggccaccatgagcggggtcaccacctgcctg
cgcttcccgggccagctcaacgccgacctgcgcaagctggccgtgaacatggtgcccttc
ccgcgcctgcacttcttcatgcccggcttcgcgccgctcaccagccggggcagccagcag
taccgggcgctgacggtgcccgagctgacccagcagatgttcgactccaagaacatgatg
gccgcctgcgacccgcgccacggccgctacctgaccgtggccgccatcttccggggccgc
atgtccatgaaggaggtggacgagcagatgctcaacgtgcagaacaagaacagcagctac
ttcgtggagtggatccccaacaacgtgaagacggccgtgtgcgacatcccgccccgcggc
ctgaagatgtcggccacgttcatcggcaacagcacggccatccaggagctgttcaagcgc
atctcggagcagttcacggccatgttccggcgcaaggccttcctgcactggtacacgggc
gagggcatggacgagatggagttcaccgaggccgagagcaacatgaacgacctggtgtcc
gagtaccagcagtaccaggacgccacggccgacgagcagggcgagttcgaggaggaggag
ggcgaggacgaggcctga

DBGET integrated database retrieval system