KEGG   Bos taurus (cow): 281605Help
Entry
281605            CDS       T01008                                 

Gene name
ADRB2
Definition
(RefSeq) beta-2 adrenergic receptor
  KO
K04142  adrenergic receptor beta-2
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04261  Adrenergic signaling in cardiomyocytes
bta04923  Regulation of lipolysis in adipocytes
bta04924  Renin secretion
bta04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    281605 (ADRB2)
   04024 cAMP signaling pathway
    281605 (ADRB2)
   04022 cGMP-PKG signaling pathway
    281605 (ADRB2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    281605 (ADRB2)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    281605 (ADRB2)
   04924 Renin secretion
    281605 (ADRB2)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    281605 (ADRB2)
  09154 Digestive system
   04970 Salivary secretion
    281605 (ADRB2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    281605 (ADRB2)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    281605 (ADRB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 281605
NCBI-ProteinID: NP_776656
BGD-bta: BT12038
Ensembl: ENSBTAG00000002144
VGNC: 25697
UniProt: Q28044
Position
7
AA seq 418 aa AA seqDB search
MGQPGNRSVFLLAPNASHAPDQNVTLERDEAWVVGMGILMSLIVLAIVFGNVLVITAIAK
FERLQTVTNYFITSLACADLVMGLAVVPFGACHILMKMWTFGNFWCEFWTSIDVLCVTAS
IETLCVIAVDRYLAITSPFKYQCLLTKNKARVVILMVWIVSGLTSFLPIQMHWYRASHKE
AINCYAKETCCDFFTNQPYAIASSIVSFYLPLVVMVFVYSRVFQVAKRQLQKIDKSEGRF
HAQNVSQVEQDGRSGLGQRRTSKFYLKEHKALKTLGIIMGTFTLCWLPFFIVNIVHVIKD
NLIRKEIYILLNWLGYINSAFNPLIYCRSPDFRIAFQELLCLRRSSLKAYGNGCSSNSND
RTDYTGEQSGYHLGEEKDSELLCEDPPGTENFVNQQGTVPSDSIDSQGRNCSTNDSLL
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atggggcagcccgggaaccgcagcgtctttttgctggcgcccaacgcaagccacgcgccg
gaccaaaacgtcacgctggaacgggacgaggcctgggttgtgggcatgggcatcctcatg
tcgcttattgtcctggccatcgtgtttggaaacgtgctagtcatcacagccattgccaag
tttgagcgtctccagacggtcaccaactacttcatcacctccctggcctgtgctgacctg
gtcatgggcctggcagtggtgccctttggggcctgccacatcctcatgaaaatgtggact
tttggcaacttctggtgtgagttttggacttccattgacgtgttatgcgtcacggccagc
attgagaccttgtgcgtgatcgctgtggatcgctacttagccatcacgtcacccttcaag
tatcagtgcctgctgaccaagaataaggcccgggtggtcattttgatggtgtggatcgtg
tctggccttacctccttcttacccattcagatgcactggtaccgggccagccacaaggaa
gccatcaactgctatgctaaggaaacctgctgtgacttcttcacgaaccaaccctatgcc
attgcctcctccattgtgtccttctaccttcccctggtggtcatggtcttcgtctactcc
agggtgttccaggtggccaaaaggcagctccagaagatcgacaaatctgagggccgcttc
catgcccaaaacgtcagtcaagtggagcaggatgggcggagcggtctaggacaacgcagg
acctccaagttctacttgaaggaacacaaagccctcaagactttaggcattatcatgggc
actttcaccctgtgctggctgcccttcttcattgtcaacattgtgcacgtgatcaaggat
aacctcatccgtaaggaaatatacatccttctaaactggttgggctacatcaactccgct
ttcaatccccttatctactgccggagcccagatttcaggattgccttccaggagcttctc
tgcctgcgcaggtcttcattgaaggcctatgggaatggctgctccagcaacagcaatgac
aggactgactacacaggggaacagagtggatatcacctgggggaggagaaagacagtgaa
cttctgtgtgaagaccccccaggcaccgaaaactttgtgaaccagcaaggtactgtgccc
agtgatagcattgattcacaagggaggaattgtagtacaaatgactcactgctgtaa

DBGET integrated database retrieval system