KEGG   Bos taurus (cow): 281607Help
Entry
281607            CDS       T01008                                 

Gene name
AGTR1
Definition
(RefSeq) type-1 angiotensin II receptor
  KO
K04166  angiotensin II receptor type 1
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04072  Phospholipase D signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04371  Apelin signaling pathway
bta04614  Renin-angiotensin system
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04927  Cortisol synthesis and secretion
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta04934  Cushing syndrome
bta05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    281607 (AGTR1)
   04020 Calcium signaling pathway
    281607 (AGTR1)
   04072 Phospholipase D signaling pathway
    281607 (AGTR1)
   04022 cGMP-PKG signaling pathway
    281607 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    281607 (AGTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    281607 (AGTR1)
   04614 Renin-angiotensin system
    281607 (AGTR1)
   04925 Aldosterone synthesis and secretion
    281607 (AGTR1)
   04927 Cortisol synthesis and secretion
    281607 (AGTR1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    281607 (AGTR1)
   04270 Vascular smooth muscle contraction
    281607 (AGTR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    281607 (AGTR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    281607 (AGTR1)
   04934 Cushing syndrome
    281607 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    281607 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    281607 (AGTR1)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    281607 (AGTR1)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Peptide
   Angiotensin
    281607 (AGTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 281607
NCBI-ProteinID: NP_776658
BGD-bta: BT11709
Ensembl: ENSBTAG00000045633
VGNC: 25745
UniProt: P25104
Position
1
AA seq 359 aa AA seqDB search
MILNSSTEDGIKRIQDDCPKAGRHNYIFIMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKSRLRRTMLVAKVTCIIIWLLAGLASLPTIIHRNVFFIENTNITVC
AFHYESQNSTLPVGLGLTKNILGFLFPFLIILTSYTLIWKTLKKAYEIQKNKPRKDDIFK
IILAIVLFFFFSWVPHQIFTFMDVLIQLGLIRDCKIEDIVDTAMPITICLAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSENGNSSTKKPAPCIEVE
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcaactcttccactgaagatggtattaaaagaatccaagatgattgtcccaaa
gctggaaggcacaattacatatttatcatgatccctactttatacagtattatctttgtg
gtggggatatttggaaacagcttggtggtgattgtcatttacttttacatgaaactgaag
actgtggccagtgtttttcttttgaatttagctctggctgacttatgctttttactgact
ttgccactgtgggctgtctacactgctatggaataccgctggcccttcggcaattaccta
tgtaagatcgcttcagccagtgtcagtttcaacctctatgccagcgtgtttctacttaca
tgtctaagcattgaccgctacctggctattgttcacccaatgaagtcccgcctccggcgc
acaatgcttgtggccaaagtcacctgcatcattatttggctgctggcaggtttggccagt
ttgccaactataatccaccgcaacgtatttttcatcgagaataccaatatcaccgtttgc
gctttccattacgaatcccaaaattctaccctcccggtagggctgggcctcaccaagaat
atattgggattcttgtttccttttctgatcattcttacaagctacactcttatttggaag
accctcaagaaggcttatgaaattcagaagaacaaaccaagaaaagatgatattttcaag
ataattttggcaatcgtgcttttctttttcttttcctgggttccccaccagatattcact
tttatggatgtgttaattcagttgggcctcatccgtgactgtaaaattgaagatattgtt
gacactgccatgcccatcactatttgcttggcttattttaacaattgcctgaatcctctc
ttttatggctttctaggaaaaaaatttaaaaaatattttctacagcttctgaaatacatt
cccccaaaggccaaatcccactcaaacctgtcgacaaaaatgagcacactctcctaccgc
ccctcagaaaatggaaactcctctaccaagaagcctgccccatgcattgaggttgagtaa

DBGET integrated database retrieval system