KEGG   Bos taurus (cow): 281612
Entry
281612            CDS       T01008                                 

Gene name
AKAP5
Definition
(RefSeq) A-kinase anchor protein 5
  KO
K16522  A-kinase anchor protein 5
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    281612 (AKAP5)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Other calcineurin-interacting proteins
     281612 (AKAP5)
SSDB
Motif
Pfam: WSK
Other DBs
NCBI-GeneID: 281612
NCBI-ProteinID: NP_776661
BGD-bta: BT12939
Ensembl: ENSBTAG00000009642
VGNC: 25786
UniProt: P24275
Position
10
AA seq 428 aa
MEITVSEIQVESKDETRSAEVRPQDERQEEKASMLCFKRRKKAAKAMKPKASSKAADAAK
KCPPEARASDQPQRPGGAWDSIKRLVTRRKRSESSKQQKPFKAKLQSEINAEDANPSKKK
AKSRLKIPCIKFSKGEKRSNHSKIIEDSDRSVKVQEAENLVTKTQTQSDDQATKSKSPQD
VREDVSQKGDDEVCESNVNNSITSPGEKVISVELELDMGHSAIQRGTLILEKDTEMLEEK
QSIQPQHVSPLEASDTEQELPVGSEVPPSSAVPDQQILEEARNGVLESGPDWKEHESREI
VVEESKPKDTELSQELDFQENEITAEKPKPEESKRMEPIAIIITDTEISEFDVKKSKNVP
KPFLISIENEQVGVFANDSGFEGRTSEQYETLLIETASSLVKNAIQLSIEQLVNEMASDD
NTINNRLQ
NT seq 1287 nt   +upstreamnt  +downstreamnt
atggagatcacagtttctgaaatacaagtagaaagcaaggatgagacgagatcagcagaa
gttagacctcaggatgagaggcaggaggaaaaagcatcgatgctctgcttcaagagaaga
aaaaaagcagccaaagcaatgaagcccaaagccagctctaaagctgctgatgcagcaaag
aagtgtcctccagaagcacgagcttctgatcagccacagcgccctggtggggcctgggac
tcaatcaaacgccttgtaacacgcaggaaaaggtcagagtcttcaaagcagcaaaagccc
tttaaggctaaactgcaatctgaaatcaatgctgaggatgctaatccttctaagaaaaag
gcaaaatccagactcaagattccctgcataaaattctcaaaaggagagaaaagaagtaat
cactccaaaatcatagaagactcagaccgcagtgtcaaagtccaagaggctgaaaatctg
gttacaaaaactcagacccaatcagatgaccaggcaacaaagagcaagtcgccccaggat
gtaagggaagatgtctcacagaaaggggacgatgaggtctgtgaatcaaatgtgaacaac
agcataacttctcctggagagaaagtgatttcagtagaacttgagttagatatgggtcat
tctgctattcaaagaggaactctaatccttgaaaaagatactgaaatgcttgaggaaaaa
caaagcattcaacctcagcacgtgagcccattggaagcttcggacacagaacaggagctc
ccagtgggttctgaagttcctccctcatctgcagtcccagatcaacaaattctggaagaa
gccagaaatggtgtcctagaaagtggaccagattggaaggagcatgaaagtagagagatt
gttgttgaggagagtaagccaaaagatactgaattgagccaggaattggattttcaagaa
aatgagatcactgcagaaaaacccaaaccagaagaaagcaaaagaatggagccaattgct
attattatcacagacactgaaatcagtgaatttgatgttaagaaatctaaaaatgtccct
aagccattcttaatttcaattgaaaatgagcaagtaggggtttttgctaatgacagtggt
tttgagggtagaacttcggaacaatatgaaacactcttaatagaaacagcttcttctctt
gtcaagaatgctatccagttgtctatagaacagcttgttaatgaaatggcctctgatgat
aatacaataaacaatcgtctacagtga

DBGET integrated database retrieval system