KEGG   Bos taurus (cow): 281614Help
Entry
281614            CDS       T01008                                 

Gene name
ALCAM
Definition
(RefSeq) CD166 antigen precursor
  KO
K06547  activated leukocyte cell adhesion molecule
Organism
bta  Bos taurus (cow)
Pathway
bta04514  Cell adhesion molecules (CAMs)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    281614 (ALCAM)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bta04515]
    281614 (ALCAM)
   04090 CD molecules [BR:bta04090]
    281614 (ALCAM)
Cell adhesion molecules [BR:bta04515]
 Immunoglobulin superfamily
  ALCAM
   281614 (ALCAM)
CD molecules [BR:bta04090]
 Proteins
  281614 (ALCAM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ig_3 C2-set_2 Ig_2 I-set ig C1-set V-set Amnionless CD34_antigen PepSY_TM DUF4366 Podoplanin FixQ
Motif
Other DBs
NCBI-GeneID: 281614
NCBI-ProteinID: NP_776663
BGD-bta: BT30459
Ensembl: ENSBTAG00000000088
VGNC: 25805
UniProt: Q9BH13
Position
1
AA seq 583 aa AA seqDB search
MASKAAPSCRLVFCLLISATVLRPGLGWYTVNSAYGDTIIMPCRVDVPQNLMFGKWKYEK
PDGSPVFIAFRSSTKKSVQYDDVPEYKDRLNLSENYTLSISNAKISDEKRFVCMLVTEDD
VFEAPTVVKVFKQPSKPEIVSKAPFLETDKLKKLGECISKDSYPDGNITWYRNGKVLQAL
EGAVVIIFRKQMDSVTQLYTMTSSLEYKTTKADIQMPFTCSVTYYGPSGQKTVYSEQAVF
DIYYPTEQVTIQVLPSKNAIKEGDNITLKCLGNGNPPPEEFLFYLPGQPEGIRSSNTYTL
TDVKRNATGDYKCSLVDKKSMIASAAITVHYLDLSLNPSGEVTKQIGDALPVSCTISASR
NATVVWMKDNVKLRSSPSFSSLHYQDAGNYVCETALQEVEGLKKRESLTLIVEGKPQIKM
TKKTDPSGLSKTIICHVEGFPKPAIQWTITGSGSVINQTEESPYINGRYYSKIIISPEEN
VTLTCTAENQLERTVNSLNVSAISIPEHDEADEISDENKEKVNDQAKLIVGIVVGLLLAA
LVAGVVYWLYMKKSKTASKHVNKDLGNMEENKKLEENNHKTEA
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgaaggcggccccctcctgccgtctggtcttctgcctcttgatctccgctact
gtccttaggccaggtcttggatggtatactgtaaactcagcatatggagataccattatc
atgccttgccgagttgatgtacctcagaatctcatgtttggcaaatggaaatatgaaaag
cccgatggctccccagtatttattgccttcaggtcctctacaaagaaaagtgtgcagtac
gacgatgtaccagaatacaaagacagattgaacctctcagaaaactatactctctctatc
agtaatgcaaagatcagtgatgaaaagagatttgtgtgcatgctagtaactgaggacgac
gtgtttgaggctcctacagtagtcaaggtgttcaagcaaccatcgaaacctgaaattgta
agcaaagccccatttcttgagacagacaagcttaaaaagttgggtgagtgcatttcaaaa
gacagttatccagatggcaacatcacatggtacaggaatggaaaagttctgcaagctctt
gaaggagcggtggtcataatttttagaaagcaaatggactcagtaactcagctctatacc
atgacttcatccctggagtacaagacaaccaaggctgacatacaaatgccattcacctgc
tctgtgacatattatggaccatctggccagaaaacagtttactctgaacaagcagttttt
gatatttactatcctacagagcaggtgacaatacaagtgctgccatcaaaaaatgccatc
aaagaaggggacaatatcactcttaaatgcttgggaaatggtaaccctcctcctgaggag
tttttgttttacttaccaggacagcctgaaggaattagaagttcaaatacttacacactg
acagatgtgaaacgcaatgcaacaggagactataaatgctccctggtagacaaaaaaagc
atgattgcttcagcagccatcacagttcactatttggatttgtccttaaacccaagtggg
gaggtgactaagcagattggcgatgctctgcctgtgtcatgcacaatatctgccagtagg
aatgcaactgtggtgtggatgaaagataacgtcaagcttcgatctagcccatcattttct
agtcttcattatcaggatgctggaaactatgtctgtgaaacagctctgcaagaggttgaa
ggattaaagaaaagagagtcgttgactctaattgtagaaggaaaacctcaaatcaaaatg
acaaagaaaactgatcccagtggactgtctaaaacaataatctgccatgtggaaggtttt
ccgaagccagctatacagtggacaattactggcagtggaagtgtcataaaccaaacagag
gaatctccgtatatcaatggcaggtattatagtaaaattatcatttcccctgaagagaat
gttacattaacttgcacagcagaaaaccagctggagagaacagtaaactccttgaatgtc
tctgctataagtattccagaacacgatgaggcagacgagataagtgatgaaaacaaagaa
aaggttaatgaccaggcaaaactaattgtgggaattgttgttggtctcctcctcgctgcc
ctagttgctggtgtcgtctattggctatacatgaagaaatcaaagactgcatcaaaacat
gtaaacaaggaccttggtaatatggaagaaaacaaaaagttagaagaaaacaatcacaaa
acagaagcctaa

DBGET integrated database retrieval system