KEGG   Bos taurus (cow): 281631
Entry
281631            CDS       T01008                                 

Symbol
APOA1
Name
(RefSeq) apolipoprotein A-I preproprotein
  KO
K08757  apolipoprotein A-I
Organism
bta  Bos taurus (cow)
Pathway
bta03320  PPAR signaling pathway
bta04975  Fat digestion and absorption
bta04977  Vitamin digestion and absorption
bta04979  Cholesterol metabolism
bta05143  African trypanosomiasis
bta05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    281631 (APOA1)
  09154 Digestive system
   04975 Fat digestion and absorption
    281631 (APOA1)
   04979 Cholesterol metabolism
    281631 (APOA1)
   04977 Vitamin digestion and absorption
    281631 (APOA1)
 09160 Human Diseases
  09174 Infectious disease: parasitic
   05143 African trypanosomiasis
    281631 (APOA1)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    281631 (APOA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    281631 (APOA1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   281631 (APOA1)
SSDB
Motif
Pfam: Apolipoprotein YtxH ApoLp-III Exonuc_VII_L DUF948 Baculo_PEP_C KMP11 DUF1664 DHC_N1 DUF4455 ApoC-I DUF445 Gp-FAR-1 CCDC90-like ORC3_ins ApoO WXG100 Gon7 HIP1_clath_bdg Prominin OmpH PIN_8 SF-assemblin Borrelia_REV DUF4407 MIF4G_like_2 Gp58 Phasin HD_4 FlgN HBM MobL HEPN_AbiU2 FAA_hydro_N_2 fvmX5 BshC Jnk-SapK_ap_N Mst1_SARAH DctP DUF3106
Other DBs
NCBI-GeneID: 281631
NCBI-ProteinID: NP_776667
BGD-bta: BT22521
Ensembl: ENSBTAG00000002258
VGNC: 26022
UniProt: P15497 V6F9A2
Position
15:complement(27503555..27505442)
AA seq 265 aa
MKAVVLTLAVLFLTGSQARHFWQQDDPQSSWDRVKDFATVYVEAIKDSGRDYVAQFEASA
LGKQLNLKLLDNWDTLASTLSKVREQLGPVTQEFWDNLEKETASLRQEMHKDLEEVKQKV
QPYLDEFQKKWHEEVEIYRQKVAPLGEEFREGARQKVQELQDKLSPLAQELRDRARAHVE
TLRQQLAPYSDDLRQRLTARLEALKEGGGSLAEYHAKASEQLKALGEKAKPVLEDLRQGL
LPVLESLKVSILAAIDEASKKLNAQ
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaaagccgtggtgctgaccttggctgtgctcttcctgacggggagccaggctcggcat
ttctggcagcaagatgacccccagtcatcctgggatcgggtgaaggattttgccaccgtg
tatgtggaagcaatcaaggatagtggcagagactatgtggcccaattcgaagcctccgct
ttgggaaaacagctcaacctgaaactcctggacaactgggacaccctggccagcacgttg
tccaaagtgcgtgaacagctgggcccagtgacccaggagttctgggacaacctggaaaag
gagaccgcgtcgctgaggcaggagatgcacaaggacctggaggaggtgaagcagaaggtg
cagccctacctggacgagttccagaagaagtggcacgaggaggtggagatctaccgccag
aaggtggcgccgctgggcgaggagtttcgcgagggcgcgcgccagaaggtgcaggagctg
caggacaagctgagccctctggcccaggagctccgcgaccgcgcgcgcgcccacgtggag
acgctgcggcagcagctggcgccctacagcgacgacctgcgccagcggctgaccgcgcgc
ctggaggcgctcaaggagggcggcggcagcctggccgagtaccacgccaaggccagcgag
cagctgaaggcgctgggcgagaaggccaagccggtgctggaggacctccgccagggcctg
ctgcccgtgctggagagcctcaaggtcagcatcctggccgccatagacgaggcctccaag
aagctgaacgcccagtga

DBGET integrated database retrieval system