KEGG   Bos taurus (cow): 281661Help
Entry
281661            CDS       T01008                                 

Gene name
CAPN1
Definition
(RefSeq) calpain-1 catalytic subunit
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
bta  Bos taurus (cow)
Pathway
bta04141  Protein processing in endoplasmic reticulum
bta04210  Apoptosis
bta04217  Necroptosis
bta04218  Cellular senescence
bta05010  Alzheimer's disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    281661 (CAPN1)
 Cellular Processes
  Cell growth and death
   04210 Apoptosis
    281661 (CAPN1)
   04217 Necroptosis
    281661 (CAPN1)
   04218 Cellular senescence
    281661 (CAPN1)
 Human Diseases
  Neurodegenerative diseases
   05010 Alzheimer's disease
    281661 (CAPN1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     281661 (CAPN1)
Peptidases [BR:bta01002]
 Cysteine Peptidases
  Family C2: calpain family
   281661 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_6 EF-hand_1 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 281661
NCBI-ProteinID: NP_776684
BGD-bta: BT12276
Ensembl: ENSBTAG00000010230
VGNC: 26740
UniProt: Q27970
Position
29
AA seq 716 aa AA seqDB search
MAEEFITPVYCTGVSAQVQKQRAKELGLGRHENAIKYLGQDYEQLRVHCLQRGALFRDEA
FPPVPQSLGFKELGPNSSKTYGIKWKRPTELFSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQDGYAGIFHFQLWQFGEWVDVVVDDLLPTKDGKLVFVHS
AQGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYNIILK
ALERGSLLGCSIDISSILDMEAVTFKKLVKGHAYSVTGAKQVNYQGQMVNLIRMRNPWGE
VEWTGAWSDGSSEWNGVDPYMREQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
QRFRNWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLEETDDPDPDDYGGRESGCS
FLLALMQKHRRRERRFGRDMETIGFAVYEVPPELMGQPAVHLKRDFFLSNASRARSEQFI
NLREVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTQELDDQVQANLPDEQVL
SEEEIDENFKSLFRQLAGEDMEISVKELRTILNRIISKHKDLRTTGFSLESCRSMVNLMD
RDGNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIEFAGFKLNKKLYEL
IITRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2151 nt NT seq  +upstreamnt  +downstreamnt
atggccgaggagttcatcactccggtgtactgcaccggggtgtctgcacaagtgcagaag
cagcgggccaaggagctgggcctgggccgccatgaaaatgccatcaagtacctgggccag
gattacgagcagctgcgggttcactgcctgcaaagaggggcccttttccgtgacgaggct
ttccccccagtgccccagagcctgggcttcaaggagctgggccccaactcctccaaaacc
tatggcatcaagtggaagcgtcccacggagctgttctcaaacccccagttcatcgtggat
ggagccacccgcacggacatctgccagggcgcactgggggactgttggctcctggctgcc
atcgcctcccttaccctcaatgacaccctcctgcaccgagtagttccacatggccaaagc
ttccaggatggctacgctggcatcttccatttccagctgtggcagtttggtgagtgggtg
gatgtggtggtggatgacctgctgcccaccaaggacgggaagctggtgtttgtgcactct
gcccaaggcaacgagttctggagcgccctgctggagaaagcctatgccaaggtgaacggc
agctacgaggccctctcaggaggcagcacatctgagggctttgaggacttcaccggcgga
gtcaccgagtggtacgagctgcgcaaggcgcccagcgacctctacaacatcatcctcaag
gccctggagcgtggctccctgctgggctgctccatcgatatctccagcattctggacatg
gaggctgtcaccttcaagaagctggtgaagggccacgcctactctgtgaccggggccaaa
caggtgaactaccagggccagatggtgaacctgatccggatgcggaacccctggggcgag
gtggagtggacaggagcctggagtgacggctcctcggagtggaacggcgtggacccttac
atgcgggagcagctccgggtcaagatggaggatggggagttctggatgtcattccgagac
ttcatgcgtgaattcacccgcctggagatctgcaacctgacacccgacgcgctcaagagc
cagaggttccgcaactggaacaccaccctgtatgagggcacctggcggcgggggagcacc
gcggggggctgccgcaactacccagccactttctgggtgaacccccagttcaagatccgg
ctggaggagacggatgacccggaccccgacgactacgggggtcgcgagtcaggctgcagc
ttcctgctcgccctcatgcagaagcaccgccgtcgggagcgccgtttcggccgtgacatg
gagaccataggcttcgctgtctacgaggtccctccggagctgatgggccagccggccgtg
catctgaagcgggacttcttcctgtccaacgcctcccgggcccggtccgagcagttcatc
aacctgcgggaggtcagcacccgcttccgcctgccgcctggggagtacgtggtggtgccc
tccaccttcgagcccaacaaggaaggtgactttgtgctgcgtttcttctcagagaagagc
gcagggacccaagagctggatgaccaggtccaggccaatctccccgacgagcaagtgctc
tcagaagaggagattgatgagaacttcaagtccctcttcagacaactggcaggggaggac
atggagatcagcgtcaaggagctgcggaccatcctcaacaggatcatcagcaaacacaaa
gacctgcggaccacgggcttcagcctggagtcctgccgcagcatggtcaacctcatggat
cgcgacggcaatggcaaactgggcctggtggagttcaacatcctatggaaccggatccgg
aattacctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctat
gaaatgcggatggccattgagtttgcaggcttcaagctcaacaagaagctgtacgagctc
attatcacccgctactcggagcccgacctggccgtggacttcgacaacttcgtgtgctgc
ctggtgcggctggagaccatgttccggtttttcaaaactctggacactgatctggatgga
gtggtgacctttgacttgtttaagtggttacagctgaccatgtttgcgtga

DBGET integrated database retrieval system