KEGG   Bos taurus (cow): 281684Help
Entry
281684            CDS       T01008                                 

Gene name
CHRM1
Definition
(RefSeq) muscarinic acetylcholine receptor M1
  KO
K04129  muscarinic acetylcholine receptor M1
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04024  cAMP signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04151  PI3K-Akt signaling pathway
bta04725  Cholinergic synapse
bta04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    281684 (CHRM1)
   04024 cAMP signaling pathway
    281684 (CHRM1)
   04151 PI3K-Akt signaling pathway
    281684 (CHRM1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    281684 (CHRM1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    281684 (CHRM1)
 09150 Organismal Systems
  09156 Nervous system
   04725 Cholinergic synapse
    281684 (CHRM1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    281684 (CHRM1)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Acetylcholine (muscarinic)
    281684 (CHRM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx 7TM_GPCR_Srbc
Motif
Other DBs
NCBI-GeneID: 281684
NCBI-ProteinID: NP_001231538
VGNC: 27318
UniProt: Q8WMX0 F1N5C5
Position
29
AA seq 460 aa AA seqDB search
MNTSAPPAVSPNITVLAPGKGPWQVAFIGITTGLLSLATVTGNLLVLISFKVNTELKTVN
NYFLLSLACADLIIGTFSMNLYTTYLLMGHWALGTLACDLWLALDYVASNASVMNLLLIS
FDRYFSVTRPLSYRAKRTPRRAALMIGLAWLVSFVLWAPAILFWQYLVGERTVLAGQCYI
QFLSQPIITFGTAMAAFYLPVTVMCALYWRIYRETENRARELAALQGSETPGKGGGSSSS
SERSQPGAEGSPETPPGRCCRCCRTPRLLQAYSWKEEEEEDEGSMESLTSSEGEEPGSEV
VIKMPMVDPEAQAPAKQPPRSSPNTVKRPTRKGRERAGKGQKPRGKEQLAKRKTFSLVKE
KKAARTLSAILLAFILTWTPYNIMVLVSTFCKDCVPETLWELGYWLCYVNSTINPMCYAL
CNKAFRDTFRLLLLCRWDKRRWRKIPKRPGSVHRTPSRQC
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgaatacctcagcgccacctgccgtcagccccaacatcaccgtcctggcaccgggaaag
ggtccctggcaagtggccttcatcgggatcaccacgggcctcctgtcactggccacagtg
acaggcaacctgctggtgctcatctctttcaaggtcaacacggagctcaagacggtcaac
aactacttcctgctgagcctggcctgtgccgacctcatcatcggtaccttctccatgaac
ctttacaccacgtatctgctcatgggccactgggctctgggcacgctggcctgcgacctc
tggctggccctggactatgtggccagcaacgcctcggtcatgaacctgctgctcatcagc
tttgaccgctacttctcggtgacccggcccctgagctaccgcgccaagcgcacaccccgc
cgggcagccctgatgatcggcctggcctggctggtttcgttcgtgctctgggccccggcc
atcctcttctggcagtacctggtaggggagcggacggtgctggccgggcagtgctacatc
cagttcctctcccagcccatcatcacctttggcacggccatggccgccttctacctcccc
gtcacggtcatgtgcgccctctactggcgcatctaccgggagacagagaaccgggcccgg
gagctggcggccctgcagggctcggagacgccggggaaggggggcggcagcagcagcagc
tcagagcggtcccagccgggggccgaaggctccccagagacccctccaggacgctgctgc
cgctgctgccggaccccccggctgctccaggcctacagctggaaggaggaagaggaggag
gacgaaggctccatggagtccctcacctcctcggagggtgaggagcctggctccgaggtg
gtgatcaagatgcccatggtggaccccgaggcgcaggcccccgccaagcagccgccccgg
agctccccgaatacggtcaagaggccgacccggaaggggcgcgagcgggcgggcaagggc
cagaagccccgtgggaaggagcaactggccaagcggaagaccttctcgctggtcaaggag
aagaaggcggctcggaccctgagcgctatcctgctggccttcatcctcacctggacgccg
tacaacatcatggtgctggtgtccaccttctgcaaggactgtgtccccgagaccctgtgg
gagctgggctactggctgtgctatgtcaacagcaccatcaaccccatgtgctacgcgctc
tgcaacaaggccttccgggacaccttccgcctgctgctgctctgccgctgggacaagcgt
cgctggcgcaagatccccaagcgccccggctctgtgcaccgcaccccctcccgccagtgc
tga

DBGET integrated database retrieval system