KEGG   Bos taurus (cow): 281731
Entry
281731            CDS       T01008                                 
Symbol
GZMB
Name
(RefSeq) duodenase-1 precursor
  KO
K01353  granzyme B [EC:3.4.21.79]
Organism
bta  Bos taurus (cow)
Pathway
bta04210  Apoptosis
bta04650  Natural killer cell mediated cytotoxicity
bta04940  Type I diabetes mellitus
bta05202  Transcriptional misregulation in cancer
bta05320  Autoimmune thyroid disease
bta05330  Allograft rejection
bta05332  Graft-versus-host disease
Brite
KEGG Orthology (KO) [BR:bta00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    281731 (GZMB)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    281731 (GZMB)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    281731 (GZMB)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    281731 (GZMB)
   05330 Allograft rejection
    281731 (GZMB)
   05332 Graft-versus-host disease
    281731 (GZMB)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    281731 (GZMB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    281731 (GZMB)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.79  granzyme B
     281731 (GZMB)
Peptidases and inhibitors [BR:bta01002]
 Serine peptidases
  Family S1: chymotrypsin family
   281731 (GZMB)
SSDB
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Other DBs
NCBI-GeneID: 281731
NCBI-ProteinID: NP_776721
BGD-bta: BT18850
Ensembl: ENSBTAG00000053015
UniProt: P80219
Structure
Position
21:34741243..34743324
AA seq 251 aa
MVLLLLLVALLSPTGEAGKIIGGHEAKPHSRPYMAFLLFKTSGKSHICGGFLVREDFVLT
AAHCLGSSINVTLGAHNIMERERTQQVIPVRRPIPHPDYNDETLANDIMLLKLTRKADIT
DKVSPINLPRSLAEVKPGMMCSVAGWGRLGVNMPSTDNLQEVDLEVQSEEKCIARFKNYI
PFTQICAGDPSKRKNSFSGDSGGPLVCNGVAQGIVSYGRNDGTTPDVYTRISSFLSWIHS
TMRRYKRQGSV
NT seq 756 nt   +upstreamnt  +downstreamnt
atggtcctgctcctgctcctggtggcccttctgtcccctactggggaggcagggaaaatc
atcgggggtcacgaggccaagccacactcccgtccctacatggcgtttcttctgttcaag
acttcagggaaatctcacatatgtgggggtttccttgtgcgtgaggacttcgtgctgaca
gcagctcactgcctgggaagctcaatcaatgtcaccctgggggcccataacatcatggaa
cgagagaggacccagcaggtcatcccagtgagaagacccatcccccacccagactataat
gatgagactttggccaacgacatcatgttactgaagctgactaggaaggctgacattacg
gataaagtgagccccatcaatctgcccaggagcttggcggaggtgaagccagggatgatg
tgcagtgtggccggctgggggcgactgggggtaaatatgccctctacagacaatctacag
gaggtagatcttgaagtccaaagtgaggagaaatgtatcgctcgcttcaaaaactacatc
cccttcacacagatatgtgctggagatccaagcaagaggaagaattctttctcgggtgac
tctgggggcccgcttgtgtgtaatggtgtggcccagggcattgtgtcctatggaagaaat
gatgggacaactccagatgtctacaccagaatctccagctttctgtcctggatccattca
acaatgagacggtacaaacgccagggatcagtgtga

DBGET integrated database retrieval system