KEGG   Bos taurus (cow): 281740Help
Entry
281740            CDS       T01008                                 

Gene name
CYP19A1
Definition
(RefSeq) aromatase
  KO
K07434  aromatase [EC:1.14.14.14]
Organism
bta  Bos taurus (cow)
Pathway
bta00140  Steroid hormone biosynthesis
bta01100  Metabolic pathways
bta04913  Ovarian steroidogenesis
Module
bta_M00110  C19/C18-Steroid hormone biosynthesis, pregnenolone => androstenedione => estrone
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    281740 (CYP19A1)
 Organismal Systems
  Endocrine system
   04913 Ovarian Steroidogenesis
    281740 (CYP19A1)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.14  aromatase
     281740 (CYP19A1)
Cytochrome P450 [BR:bta00199]
 Cytochrome P450, animal type
  CYP19 family
   281740 (CYP19A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 281740
NCBI-ProteinID: NP_776730
BGD-bta: BT17636
Ensembl: ENSBTAG00000014890
UniProt: P46194
Position
10
AA seq 503 aa AA seqDB search
MLLEVLNPRHYNVTSMVSEVVPIASIAILLLTGFLLLVWNYEDTSSIPGPSYFLGIGPLI
SHCRFLWMGIGSACNYYNKMYGEFMRVWVCGEETLIISKSSSMFHVMKHSHYISRFGSKL
GLQFIGMHEKGIIFNNNPALWKAVRPFFTKALSGPGLVRMVTICADSITKHLDRLEEVCN
DLGYVDVLTLMRRIMLDTSNMLFLGIPLDESAIVVKIQGYFDAWQALLLKPDIFFKISWL
CRKYEKSVKDLKDAMEILIEEKRHRISTAEKLEDSIDFATELIFAEKRGELTRENVNQCI
LEMLIAAPDTMSVSVFFMLFLIAKHPQVEEAIIREIQTVVGERDIRIDDMQKLKVVENFI
NESMRYQPVVDLVMRKALEDDVIDGYPVKKGTNIILNLGRMHRLEFFPKPNEFTLENFAK
NVPYRYFQPFGFGPRACAGKYITMVMMKVVLVTLLRRFHVQTLQGRCVEKMQKKNDLSLH
PDETRDRLEMIFTPRNSDKCLER
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgcttttggaagtgctgaacccaaggcattacaacgtcaccagcatggtgtccgaagtt
gtgcctattgccagcattgcaatcctgctgctcactggatttcttctcttggtttggaat
tatgaggacacatcctcaataccaggtcccagctactttctgggaattgggcccctcatt
tcccactgcaggttcctctggatggggatcggcagtgcctgcaattactacaacaagatg
tatggagaattcatgagagtctgggtatgtggagaggaaacccttattattagcaagtcc
tcaagtatgttccatgtaatgaagcacagtcactacatatcccgatttggcagtaaactt
gggttgcagttcatcggcatgcacgagaaaggcatcatatttaacaataatccagcactc
tggaaagctgttcgacctttctttacaaaagctttgtccggccctggcctggtgcgcatg
gtgaccatctgtgctgattccatcaccaagcatctggacaggctggaggaggtctgcaat
gacttgggctatgtggacgtgttgaccctcatgcggcgcatcatgctggacacctctaac
atgctcttcctggggatccccttggatgaaagtgccatcgtggttaaaatccaggggtat
tttgatgcatggcaagctctccttctcaaaccagacatcttctttaagatttcttggctg
tgcagaaagtatgaaaagtctgtcaaggacttgaaagatgccatggaaattctcatagaa
gaaaaaagacacaggatttcaacagcagagaagctggaagacagcatagatttcgccact
gagttgatttttgctgagaaacgtggtgaacttacaagagagaatgtaaaccagtgcata
ttggaaatgctgatcgcagcgccagacaccatgtctgtttctgtgttcttcatgctgttt
cttattgcaaagcatccccaggttgaagaggcaataataagggaaatccagactgttgtt
ggtgaaagagacataaggattgatgatatgcaaaagctaaaagtggtggaaaactttatt
aatgagagcatgcggtaccagcccgttgtggacctggtcatgcgcaaagccttagaggat
gatgtcatcgatggctacccggtgaaaaaggggactaacattatcctgaatcttggaaga
atgcatagactcgagtttttcccaaagcctaatgagtttactcttgaaaactttgccaag
aatgttccttacaggtactttcagccatttggctttgggccccgggcctgtgcgggaaag
tacatcaccatggtgatgatgaaggtcgtcctggtcacccttctgagacgcttccacgtg
cagactttgcaaggtcggtgcgttgagaagatgcagaagaaaaatgacttatccttgcat
ccagacgagaccagagaccggctagaaatgattttcaccccaagaaattcagacaagtgc
ctcgagcgctaa

DBGET integrated database retrieval system