KEGG   Bos taurus (cow): 281751
Entry
281751            CDS       T01008                                 

Gene name
EIF4E
Definition
(RefSeq) eukaryotic translation initiation factor 4E
  KO
K03259  translation initiation factor 4E
Organism
bta  Bos taurus (cow)
Pathway
bta01521  EGFR tyrosine kinase inhibitor resistance
bta03013  RNA transport
bta04066  HIF-1 signaling pathway
bta04150  mTOR signaling pathway
bta04151  PI3K-Akt signaling pathway
bta04211  Longevity regulating pathway
bta04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    281751 (EIF4E)
 09130 Environmental Information Processing
  09132 Signal transduction
   04066 HIF-1 signaling pathway
    281751 (EIF4E)
   04151 PI3K-Akt signaling pathway
    281751 (EIF4E)
   04150 mTOR signaling pathway
    281751 (EIF4E)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    281751 (EIF4E)
  09149 Aging
   04211 Longevity regulating pathway
    281751 (EIF4E)
 09160 Human Diseases
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    281751 (EIF4E)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:bta03019]
    281751 (EIF4E)
   03012 Translation factors [BR:bta03012]
    281751 (EIF4E)
Messenger RNA biogenesis [BR:bta03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     281751 (EIF4E)
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     281751 (EIF4E)
Translation factors [BR:bta03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    281751 (EIF4E)
SSDB
Motif
Pfam: IF4E
Other DBs
NCBI-GeneID: 281751
NCBI-ProteinID: NP_776735
BGD-bta: BT20677
Ensembl: ENSBTAG00000009522
VGNC: 28408
UniProt: Q9N0T5
Position
6
AA seq 217 aa
MATVEPETTPTPNPPPTEEEKTESNQEVANPEHYIKHPLQNRWALWFFKNDKSKTWQANL
RLISKFDTVEDFWALYNHIQLSSNLMPGCDYSLFKDGIEPMWEDEKNKRGGRWLITLNKQ
QRRSDLDRFWLETVLCLIGESFDDYSDDVCGAVVNVRAKGDKIAIWTTECENREAVTHIG
RVYKERLGLPPKIVIGYQSHADTATKSGSTTKNRFVV
NT seq 654 nt   +upstreamnt  +downstreamnt
atggcgactgtggaaccggaaaccacccctactccgaatcccccgcctacagaagaagag
aaaacagaatctaatcaggaggttgctaacccagaacactatattaaacaccctttacag
aacagatgggcactctggttttttaaaaatgataaaagcaaaacttggcaagcaaacctt
cgattgatctctaagtttgatactgttgaagacttttgggctctgtacaaccatatccag
ttgtctagtaatttaatgcctggctgtgactactcactttttaaggatggtattgagcct
atgtgggaagatgagaaaaacaaacgaggaggacgatggctaattacactgaacaaacag
cagagacgaagtgacctcgatcgtttttggctagagacagtgctgtgccttattggagaa
tcttttgatgactacagtgatgatgtatgtggagctgttgttaatgttagagctaaaggt
gataaaatagcaatatggactactgaatgtgaaaacagagaagctgttacacatataggg
agggtatacaaggaaaggttaggacttcctccaaagatagtgattggttatcagtcccat
gcagacacagctactaagagcggctccaccactaaaaataggtttgttgtttaa

DBGET integrated database retrieval system