KEGG   Bos taurus (cow): 281803Help
Entry
281803            CDS       T01008                                 

Gene name
PDIA3
Definition
(RefSeq) protein disulfide-isomerase A3 precursor
  KO
K08056  protein disulfide isomerase family A, member 3 [EC:5.3.4.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04141  Protein processing in endoplasmic reticulum
bta04612  Antigen processing and presentation
bta05163  Human cytomegalovirus infection
Brite
KEGG Orthology (KO) [BR:bta00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    281803 (PDIA3)
 Organismal Systems
  Immune system
   04612 Antigen processing and presentation
    281803 (PDIA3)
 Human Diseases
  Infectious diseases
   05163 Human cytomegalovirus infection
    281803 (PDIA3)
Enzymes [BR:bta01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     281803 (PDIA3)
Chaperones and folding catalysts [BR:bta03110]
 Protein folding catalysts
  Protein disulfide isomerase
   281803 (PDIA3)
Membrane trafficking [BR:bta04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    281803 (PDIA3)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   281803 (PDIA3)
  Exosomal proteins of colorectal cancer cells
   281803 (PDIA3)
  Exosomal proteins of bladder cancer cells
   281803 (PDIA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_8 Thioredoxin_7 OST3_OST6 AhpC-TSA Thioredoxin_4 Thioredoxin_3
Motif
Other DBs
NCBI-GeneID: 281803
NCBI-ProteinID: NP_776758
BGD-bta: BT15601
Ensembl: ENSBTAG00000017196
VGNC: 32697
UniProt: A5D7E8
Position
21
AA seq 505 aa AA seqDB search
MRLRRLALFPGLALLLAAARLAAASDVLELTDDNFESRITDTGSSGLMLVEFFAPWCGHC
KKLAPEYEAAATRLKGIVPLAKVDCTANTNTCNKYGVSGYPTLKIFRDGEESGAYDGPRT
ADGIVSHLKKQAGPASVPLKSEEEFEKFISDKDASVVGFFKDLFSEAHSEFLKAASNLRD
NYRFAHTNVESLVNKYDDDGEGITLFRPSHLTNKFEDKTVAYTEQKMTSGKIKRFIQENI
FGICPHMTEDNKDLLQGKDLLIAYYDVDYEKNAKGSNYWRNRVMMVAKKFLDAGKKLHFA
VASRKTFSHELSDFGLESTTGEIPVVAVRTAKGEKFVMQEEFSRDGKALERFLEDYFDGN
LKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELG
EKLRKDPNIVIAKMDATANDVPSPYEVRGFPTIYFSPANKKQNPKKYEGGRELSDFISYL
KREATNPPVIQEEKPKKKKKAQEDL
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgcgcctccgccgcctagcgctgttcccaggcctggcgctgctcctcgccgcggcccgc
ctcgctgctgcctccgatgtgctggaactcacggacgacaacttcgagagtcgcatcacc
gacacgggctcttctggcctcatgctcgtcgagttcttcgccccctggtgtggacactgc
aaaaagcttgccccagagtatgaagctgcagctaccagattaaaaggaatagtcccgtta
gcaaaggtggattgtactgccaacacgaacacctgtaataagtatggagtgagtggatat
ccaaccctgaagatatttagagatggtgaagaatcaggtgcctatgatgggcctaggact
gccgatggaattgtcagccacctgaagaaacaggctggaccagcttcagttcctctcaag
tctgaggaagaatttgaaaagttcattagcgataaagatgcttctgtggtgggttttttc
aaggatttattcagtgaagctcactctgagtttctaaaagcagccagcaacttgagggat
aactaccggtttgcacacaccaatgttgaatctctggtgaacaaatacgatgacgatgga
gagggtatcaccttgtttcgtccttcccatctgacgaacaagtttgaagacaagactgtg
gcatatacagaacagaaaatgaccagtgggaagattaaaagatttattcaggaaaacatt
tttggtatctgccctcacatgacagaagacaataaagatttactacagggcaaggattta
ctcatcgcttactatgatgtggactatgaaaagaatgctaaaggttccaactactggaga
aacagagtaatgatggtggcaaagaaattcctggatgctgggaagaaactccattttgct
gtagctagccgtaaaacctttagccatgaactttcagattttggcttggaaagcactact
ggagagattcctgttgttgctgtcagaaccgcaaaaggagagaagtttgtcatgcaggag
gagttctcgcgtgatggcaaggctcttgagagattcctggaggattactttgacggcaac
ctgaagagatacctgaagtctgagcctatccctgagagcaatgatgggcctgtaaaggta
gtggtagcagagaattttgatgaaatagtgaataatgaaaataaagatgtgctgattgag
ttttatgctccttggtgtggtcactgtaagaatctggagcctaagtataaagaactggga
gagaagctcagaaaagatccaaatattgtcatagccaagatggatgctacagccaacgat
gtgccttctccatatgaagtcagaggttttcctaccatctacttctctccagccaacaag
aagcaaaatccaaagaaatatgaaggtggccgtgaattaagtgattttattagctatcta
aagcgagaggctacaaacccccctgtaattcaagaagaaaaacccaagaagaagaagaag
gcacaggaggatctctaa

DBGET integrated database retrieval system