KEGG   Bos taurus (cow): 281831Help
Entry
281831            CDS       T01008                                 

Gene name
HSPA8
Definition
(RefSeq) heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
bta  Bos taurus (cow)
Pathway
bta03040  Spliceosome
bta04010  MAPK signaling pathway
bta04141  Protein processing in endoplasmic reticulum
bta04144  Endocytosis
bta04213  Longevity regulating pathway - multiple species
bta04612  Antigen processing and presentation
bta04915  Estrogen signaling pathway
bta05134  Legionellosis
bta05145  Toxoplasmosis
bta05162  Measles
Brite
KEGG Orthology (KO) [BR:bta00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    281831 (HSPA8)
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    281831 (HSPA8)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    281831 (HSPA8)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    281831 (HSPA8)
 09150 Organismal Systems
  09151 Immune system
   04612 Antigen processing and presentation
    281831 (HSPA8)
  09152 Endocrine system
   04915 Estrogen signaling pathway
    281831 (HSPA8)
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    281831 (HSPA8)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    281831 (HSPA8)
  09172 Infectious disease: viral
   05162 Measles
    281831 (HSPA8)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    281831 (HSPA8)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    281831 (HSPA8)
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:bta03041]
    281831 (HSPA8)
   03009 Ribosome biogenesis [BR:bta03009]
    281831 (HSPA8)
   03110 Chaperones and folding catalysts [BR:bta03110]
    281831 (HSPA8)
   04131 Membrane trafficking [BR:bta04131]
    281831 (HSPA8)
   03051 Proteasome [BR:bta03051]
    281831 (HSPA8)
   03029 Mitochondrial biogenesis [BR:bta03029]
    281831 (HSPA8)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    281831 (HSPA8)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     281831 (HSPA8)
Spliceosome [BR:bta03041]
 Complex B
  Other components
   Prp19 complex
    281831 (HSPA8)
 Complex C
   Prp19-CDC5 complex
    281831 (HSPA8)
Ribosome biogenesis [BR:bta03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    281831 (HSPA8)
Chaperones and folding catalysts [BR:bta03110]
 Heat shock proteins
  HSP70 / DNAK
   281831 (HSPA8)
Membrane trafficking [BR:bta04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    281831 (HSPA8)
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    281831 (HSPA8)
Proteasome [BR:bta03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    281831 (HSPA8)
Mitochondrial biogenesis [BR:bta03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    281831 (HSPA8)
Exosome [BR:bta04147]
 Exosomal proteins
  Proteins found in most exosomes
   281831 (HSPA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl FGGY_C DDR HORMA Ppx-GppA MetOD2
Motif
Other DBs
NCBI-GeneID: 281831
NCBI-ProteinID: NP_776770
BGD-bta: BT12679
Ensembl: ENSBTAG00000013162
UniProt: P19120
Structure
PDB: 

Position
15
AA seq 650 aa AA seqDB search
MSKGPAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFDDAVVQSDMKHWPFMVVNDAGRPKVQVEYKGETKSFYPEEVS
SMVLTKMKEIAEAYLGKTVTNAVVTVPAYFNDSQRQATKDAGTIAGLNVLRIINEPTAAT
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FIAEFKRKHKKDISENKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGIDFYTSITRA
RFEELNADLFRGTLDPVEKALRDAKLDKSQIHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILSGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGILNVSAVDKSTGKENKITITNDKGRLSKEDIERMVQEAEKYKAEDEKQRDKVSSKN
SLESYAFNMKATVEDEKLQGKINDEDKQKILDKCNEIINWLDKNQTAEKEEFEHQQKELE
KVCNPIITKLYQSAGGMPGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD
NT seq 1953 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggacctgcagttggcattgatcttggcaccacctattcttgtgtgggtgtc
ttccagcacggaaaggtggaaataattgccaatgatcaggggaaccgaaccaccccaagc
tatgtcgcctttactgataccgaacggttaatcggtgatgcagcaaagaaccaagtcgca
atgaatcccaccaacacggtttttgatgccaaacgacttattggacgaagatttgatgat
gctgttgtccagtctgatatgaaacattggcccttcatggtggtgaatgatgctggcagg
cctaaggttcaagtagaatacaagggagagacaaagagtttttacccagaggaggtgtca
tccatggtcctgacaaagatgaaggaaatcgcagaagcctaccttgggaagacggttacc
aacgctgtcgtcacagtacctgcctattttaatgactctcagcgtcaggctaccaaagat
gctggaactattgctggtctcaacgtacttcgaatcatcaatgagccaactgctgctact
attgcctatggcttagacaaaaaggttggagcagaaagaaacgtgctgatctttgattta
gggggtggcacttttgatgtgtcaatcctcactattgaggatggaatctttgaggtcaaa
tctacagctggagatactcacttgggtggagaagactttgacaaccgcatggttaaccat
tttattgcggagttcaagcgtaaacacaagaaggatatcagtgaaaacaagagggctgtc
cgtcgcctccgtactgcttgtgagcgtgctaagcgcactctctcttccagcacccaggcc
agtattgagattgattccctctatgaaggaatcgacttctatacctctattacccgtgcc
cgatttgaagaattgaatgctgacttgttccgtggcaccctggaccctgtggagaaagcc
cttagggatgccaaactggacaagtctcagattcatgatattgtcttggttggtggctca
acccgtatccccaagattcagaaacttctccaggacttcttcaacgggaaagaactgaat
aagagcatcaaccctgatgaggctgttgcatatggtgcagctgtccaggcagccattttg
tctggagacaaatctgaaaatgttcaagacttgctgctgttggatgtcactcctctttcc
cttggaattgaaactgctggtggagtcatgactgtcctcatcaagcgcaatactaccatt
cctaccaagcagacgcagactttcaccacctactctgacaaccagcctggtgtgctcatt
caggtttatgaaggtgagcgtgccatgaccaaggataacaacctgcttggcaagtttgaa
ctcacgggcatacctcctgccccccgtggtgttcctcagattgaagtcacttttgatatt
gatgccaatggcatcctcaatgtttctgctgtggataagagcacaggaaaagagaacaag
attaccatcactaatgacaagggccgcttgagcaaggaagacattgaacgcatggttcaa
gaagcagagaagtacaaagctgaagatgagaagcagcgggacaaggtgtcttcaaagaat
tcgcttgaatcctacgccttcaacatgaaagctactgttgaggatgagaaacttcagggc
aagattaatgatgaggacaaacagaagattcttgacaagtgtaatgaaataatcaactgg
ctggataagaaccagactgcagagaaggaagaatttgaacatcagcagaaggagctggaa
aaagtctgcaaccccatcattaccaagctgtaccagagtgcaggaggcatgcctggggga
atgccaggaggaatgcctgggggcttccctggtggtggagctcctccatcaggtggtgcc
tcctctgggcccaccattgaagaggttgattaa

DBGET integrated database retrieval system