KEGG   Bos taurus (cow): 281865Help
Entry
281865            CDS       T01008                                 

Gene name
IMPA1
Definition
(RefSeq) inositol monophosphatase 1
  KO
K01092  myo-inositol-1(or 4)-monophosphatase [EC:3.1.3.25]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta01100  Metabolic pathways
bta04070  Phosphatidylinositol signaling system
Module
bta_M00131  Inositol phosphate metabolism, Ins(1,3,4,5)P4 => Ins(1,3,4)P3 => myo-inositol
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    281865 (IMPA1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    281865 (IMPA1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.25  inositol-phosphate phosphatase
     281865 (IMPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Inositol_P Anti-TRAP
Motif
Other DBs
NCBI-GeneID: 281865
NCBI-ProteinID: NP_776786
BGD-bta: BT20268
Ensembl: ENSBTAG00000011709
VGNC: 30184
UniProt: P20456
Structure
PDB: 

Position
14
AA seq 277 aa AA seqDB search
MADPWQECMDYAVTLAGQAGEVVREALKNEMNIMVKSSPADLVTATDQKVEKMLITSIKE
KYPSHSFIGEESVAAGEKSILTDNPTWIIDPIDGTTNFVHGFPFVAVSIGFVVNKKMEFG
IVYSCLEDKMYTGRKGKGAFCNGQKLQVSHQEDITKSLLVTELGSSRTPETVRIILSNIE
RLLCLPIHGIRGVGTAALNMCLVAAGAADAYYEMGIHCWDVAGAGIIVTEAGGVLLDVTG
GPFDLMSRRVIASSNKTLAERIAKEIQIIPLQRDDED
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggctgatccttggcaggaatgcatggattatgcagtaaccctggcaggacaagctgga
gaggtggttcgtgaagcgctcaagaatgaaatgaatattatggttaaaagttctccggct
gatttggtaactgctactgaccaaaaagttgaaaaaatgcttatcacatccataaaggaa
aagtatccatctcacagtttcattggtgaggaatctgtggcagctggggaaaaaagtatc
ttaaccgacaaccctacatggatcattgaccctattgatggaacaactaactttgtacat
ggatttccttttgtagctgtttcaattggctttgtggtaaataaaaagatggagtttgga
attgtgtacagttgcctggaggataagatgtacactggccggaaaggaaaaggtgccttt
tgtaatggtcaaaaactacaggtttcacaccaagaagatattaccaaatctctcttggtg
acagagttgggctcttccagaacaccagagactgtgagaattattctttctaatatagaa
aggcttctttgccttcccatccatgggatccggggtgttggaacagcagctctgaacatg
tgcctggtggccgctggggctgcggacgcgtattatgaaatggggatccactgctgggat
gttgcaggcgccggcatcattgtgactgaagctggcggagtgctcctggatgtcacaggt
ggaccatttgatttgatgtcacgaagagtaattgcttcaagcaataaaacattagcagaa
aggatagccaaagaaattcagataatacctcttcaaagagatgatgaagattaa

DBGET integrated database retrieval system