KEGG   Bos taurus (cow): 281879Help
Entry
281879            CDS       T01008                                 

Gene name
ITPR3
Definition
(RefSeq) inositol 1,4,5-trisphosphate receptor type 3
  KO
K04960  inositol 1,4,5-triphosphate receptor type 3
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04070  Phosphatidylinositol signaling system
bta04114  Oocyte meiosis
bta04210  Apoptosis
bta04218  Cellular senescence
bta04270  Vascular smooth muscle contraction
bta04371  Apelin signaling pathway
bta04540  Gap junction
bta04611  Platelet activation
bta04621  NOD-like receptor signaling pathway
bta04625  C-type lectin receptor signaling pathway
bta04713  Circadian entrainment
bta04720  Long-term potentiation
bta04723  Retrograde endocannabinoid signaling
bta04724  Glutamatergic synapse
bta04725  Cholinergic synapse
bta04726  Serotonergic synapse
bta04728  Dopaminergic synapse
bta04730  Long-term depression
bta04742  Taste transduction
bta04750  Inflammatory mediator regulation of TRP channels
bta04911  Insulin secretion
bta04912  GnRH signaling pathway
bta04915  Estrogen signaling pathway
bta04918  Thyroid hormone synthesis
bta04921  Oxytocin signaling pathway
bta04922  Glucagon signaling pathway
bta04924  Renin secretion
bta04925  Aldosterone synthesis and secretion
bta04927  Cortisol synthesis and secretion
bta04928  Parathyroid hormone synthesis, secretion and action
bta04934  Cushing syndrome
bta04970  Salivary secretion
bta04971  Gastric acid secretion
bta04972  Pancreatic secretion
bta05010  Alzheimer disease
bta05163  Human cytomegalovirus infection
bta05167  Kaposi sarcoma-associated herpesvirus infection
bta05170  Human immunodeficiency virus 1 infection
bta05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    281879 (ITPR3)
   04020 Calcium signaling pathway
    281879 (ITPR3)
   04070 Phosphatidylinositol signaling system
    281879 (ITPR3)
   04022 cGMP-PKG signaling pathway
    281879 (ITPR3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    281879 (ITPR3)
   04210 Apoptosis
    281879 (ITPR3)
   04218 Cellular senescence
    281879 (ITPR3)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    281879 (ITPR3)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    281879 (ITPR3)
   04621 NOD-like receptor signaling pathway
    281879 (ITPR3)
   04625 C-type lectin receptor signaling pathway
    281879 (ITPR3)
  09152 Endocrine system
   04911 Insulin secretion
    281879 (ITPR3)
   04922 Glucagon signaling pathway
    281879 (ITPR3)
   04912 GnRH signaling pathway
    281879 (ITPR3)
   04915 Estrogen signaling pathway
    281879 (ITPR3)
   04921 Oxytocin signaling pathway
    281879 (ITPR3)
   04918 Thyroid hormone synthesis
    281879 (ITPR3)
   04928 Parathyroid hormone synthesis, secretion and action
    281879 (ITPR3)
   04924 Renin secretion
    281879 (ITPR3)
   04925 Aldosterone synthesis and secretion
    281879 (ITPR3)
   04927 Cortisol synthesis and secretion
    281879 (ITPR3)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    281879 (ITPR3)
  09154 Digestive system
   04970 Salivary secretion
    281879 (ITPR3)
   04971 Gastric acid secretion
    281879 (ITPR3)
   04972 Pancreatic secretion
    281879 (ITPR3)
  09156 Nervous system
   04724 Glutamatergic synapse
    281879 (ITPR3)
   04725 Cholinergic synapse
    281879 (ITPR3)
   04728 Dopaminergic synapse
    281879 (ITPR3)
   04726 Serotonergic synapse
    281879 (ITPR3)
   04720 Long-term potentiation
    281879 (ITPR3)
   04730 Long-term depression
    281879 (ITPR3)
   04723 Retrograde endocannabinoid signaling
    281879 (ITPR3)
  09157 Sensory system
   04742 Taste transduction
    281879 (ITPR3)
   04750 Inflammatory mediator regulation of TRP channels
    281879 (ITPR3)
  09159 Environmental adaptation
   04713 Circadian entrainment
    281879 (ITPR3)
 09160 Human Diseases
  09161 Cancers: Overview
   05205 Proteoglycans in cancer
    281879 (ITPR3)
  09164 Neurodegenerative diseases
   05010 Alzheimer disease
    281879 (ITPR3)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    281879 (ITPR3)
  09172 Infectious diseases: Viral
   05170 Human immunodeficiency virus 1 infection
    281879 (ITPR3)
   05163 Human cytomegalovirus infection
    281879 (ITPR3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    281879 (ITPR3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bta01009]
    281879 (ITPR3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:bta04040]
    281879 (ITPR3)
Protein phosphatases and associated proteins [BR:bta01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     281879 (ITPR3)
Ion channels [BR:bta04040]
 Ligand-gated channels
  IP3 receptor
   281879 (ITPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ins145_P3_rec RYDR_ITPR MIR RIH_assoc Ion_trans
Motif
Other DBs
NCBI-GeneID: 281879
NCBI-ProteinID: NP_776795
BGD-bta: BT13799
Ensembl: ENSBTAG00000013245
VGNC: 30348
UniProt: Q8WN95
Position
23
AA seq 2664 aa AA seqDB search
MSEMSSFLHIGDIVSLYAEGSVNGFISTLGLVDDRCVVEPAAGDLDNPPKKFRDCLFKVC
PMNRYSAQKQYWKAKQTKQDKEKIADVVLLQKLQHAAQMEQKQNDTENKKVHGDVVKYGS
VIQLLHMKSNKYLTVNKRLPALLEKNAMRVTLDATGNEGSWLFIQPFWKLRSNGDNVVVG
DKVILNPVNAGQPLHASNYELSDNAGCKEVNSVNCNTSWKINLFMQFRDHLEEVLKGGDV
VRLFHAEQEKFLTCDEYRGKLQVFLRTTLRQSATSATSSNALWEVEVVHHDPCRGGAGHW
NGLYRFKHLATGNYLAAEENPSYKGDASDPKAAGTGAQGRTGRRNAGEKIKYRLVAVPHG
NDIASLFELDPTTLQKTDSFVPRNSYVRLRHLCTNTWIQSTNVPIDVEEERPIRLMLGTC
PTKEDKEAFAIVSVPVSEIRDLDFANDASSMLASAVEKLHEGFISQNDRRFVIQLLEDLV
FFVSDVPNNGQNVLDIMVTKPNRERQKLMREQNILKQIFGILKAPFRDKGGEGPLVRLEE
LSDQKNAPYQHMFRLCYRVLRHSQEDYRKNQEHIAKQFGMMQSQIGYDILAEDTITALLH
NNRKLLEKHITKTEVETFVSLVRKNREPRFLDYLSDLCVSNHIAIPVTQELICKCVLDPK
NSDILIQTELRPVKEMAQSHEYLSIEYSEEEVWLTWTDKNNEHHEKSVRQLAQEARAGNA
HDENVLSYYRYQLKLFARMCLDRQYLAIDEISQQLGVDLIFLCMADEMLPFDLRASFCHL
MLHVHVDRDPQELVTPVKFARLWTEIPTAITIKDYDSNLNASRDDKKNKFASTMEFVEDY
LNNVVSEAVPFANEEKNKLTFEVVSLAHNLIYFGFYSFSELLRLTRTLLGIIDCVQAYED
PGGKNVRRSTQGVGHMMSTMVLNRKQSVFGGPSLPAGAGAPEPLDGSKFEENEDIVVMET
KLKILEILQFILNVRLDYRISYLLSVFKKEFVEVFPMQDSGADGTAPAFDSTTANMNLDR
IGEQAEAMFGVGKTSSMLEVDDEGGRMLLRVLIHLTMHDYAPLVSGALQLLFKHFSQRQE
VMHTFKQVQLLISAQDVENYKVIKSELDRLRTMVEKSELWVDKKGASKGEEGEAGPAKDK
KERPTDEEGFLHPPGEKSSENYQIVKGILERLNKMCGVGEQMRKKQQRLLKNMDAHKVML
DLLQIPYDKGDAKMMEILRYTHQFLQKFCAGNPGNQALLHKHLHLFLTPGLLEAETMQHI
FLNNYQLCSEIGEPVLQHFVHLLATHGHHVQYLDFLHTVIKAEGKYVKKCQDMIMTEPAN
AGDDVVVFYNDKASLAHLLDMMKAARDGVEDHSPLMYHISLVDLLAACAEGKNVYTEIKC
TSLLPLEDVVSVVTHEDCITEVKMAYVNFVNHCYVDTEVEMKEIYTSNHIWTLFENFTLD
MARVCSKREKRLADPALEKYVLTVVLDTISAFFSSPFSENSTSLQTHQTIVVQLLQSTMR
LLECPWLQQQHKGSVEACIRTLAMVAKGRAISLPMDLDAHISSLLSSGASCVAAAQRNAS
NYKTATRAFPRVMPTANQWDYKNIIEKLQDIITALEERLRPLVQAELSVLVDVLHWPELL
FLEGSDAYQRCESGGFLSKLIQHTKDLMESEEKLCVKVLRTLQQMLLKKTKYGDRGNQLR
KMLLQNYLQNRKSSSRGDLPDPMGTGLDQDWSAIAATQCRLDKEGATKLVCDLITSTKNE
KIFQESIGLAIRLLDGGNTEIQKSFYNLMTSDKKSERFFKVLHDRMKRAQQETKSTVAVN
MSDLGSQPREDREQADPTSKGRVASFSMPSSSSRYALGPSLRRGHEVGERVQSNEMGTSV
LIMQPILRFLQLLCENHNRDLQNFLRCQNNKTNYNLVCETLQFLDIMCGSTTGGLGLLGL
YINEDNVGLVIQTLETLTEYCQGPCHENQTCIVTHESNGIDIITALILNDISPLCKYRMD
LVLQLKDNASKLLLALMESRHDSENAERILISLRPQELVDVIKKAYLQEEERENSDVSPR
EVGHNIYILALQLSRHNKQLQHLLKPVKRIQEEEAEGISSMLSLNNKQLTQMLKSSAPVQ
EQEEDPLAYYENHTSQIEIVRQDRSMEQIVFPVPGICQFLTEETKHRLFTTTEQDEQGSK
VSDLFDQPSFLHNEMEWQRKLRSMPLIYWFSRRMTLWGSISFNLAVFINIIIAFFYPYVE
GASTGVLGSPLISLLFWILICFSIAALFTKRYSVRPLIVALILRSIYYLGIGPTLNILGA
LNLTNKIVFVVSFVGNRGTFIRGYKAMVMDMEFLYHVGYILTSVLGLFAHELFYSILLFD
LIYREETLFNVIKSVTRNGRSILLTALLALILVYLFSIVGFLFLKDDFILEVDRLPGNHS
RANPLGMPHGAATFVNTCSGDNVDCVSGVSVPEVLAEDEEPDSTERACDTLLMCIVTVMN
HGLRNGGGVGDILRKPSKDESLFPARVVYDLLFFFIVIIIVLNLIFGVIIDTFADLRSEK
QKKEEILKTTCFICGLERDKFDNKTVSFEEHIKFEHNMWNYLYFIVLVRVKNKTDYTGPE
SYVAQMIKNKNLDWFPRMRAMSLVSSEGEGEQNEIRILQDKLSATMKLVSHLTAQLSELK
EQMTEQRKRRQRLGFVDVQNCMSR
NT seq 7995 nt NT seq  +upstreamnt  +downstreamnt
atgagcgagatgtccagctttcttcacatcggggacatcgtctccctgtacgccgagggc
tccgtcaatggcttcatcagcactttggggttggtggatgaccgctgtgtggtggagccc
gcggctggtgacctggacaacccccctaagaagttccgagactgcctcttcaaggtgtgt
cccatgaaccgctactcggcccagaagcagtactggaaggccaagcagaccaagcaggac
aaggagaagatcgccgacgtagtgctgctgcagaagttacagcacgcagcccagatggag
cagaagcagaacgacacggagaacaagaaggtgcacggggacgtcgtgaagtacggcagc
gtcatccagctcttgcacatgaagagtaacaagtacctgaccgtcaacaagcggctgcca
gccctgctggagaagaatgccatgagggtgacgctggacgccacgggcaatgagggctcc
tggctcttcatccagcccttctggaagctgcggagcaacggggacaacgtggttgtgggg
gacaaggtgatcctgaatcccgtcaacgccgggcagcctctgcacgccagcaattacgag
ctcagcgacaacgccggctgcaaggaggtcaactctgtgaactgcaacaccagctggaag
atcaacctgttcatgcagttccgagaccacctggaggaggtgctgaaagggggagacgtg
gtgcggctgttccacgcggagcaggagaagttcctgacgtgcgacgagtacaggggcaag
ctgcaggtgttcctgcgcaccacgctgcgccagtctgccacatcagctaccagctccaac
gccctctgggaggtggaggtggtccaccacgacccgtgccgtggaggagctggccactgg
aacggcctctaccgcttcaagcacctggccaccggcaactacctggctgctgaggagaac
cccagctacaagggtgatgcctctgatcccaaggcagcaggcacgggtgcgcagggccgc
acaggtcgccggaacgctggggagaagatcaagtaccgcctggtggctgtgccccacggc
aacgacatcgcttccctcttcgagctggaccccaccacgctgcagaagaccgactccttc
gtgccccggaactcctacgtccggctgcggcacctgtgcaccaacacttggatccagagc
accaacgtgcccattgatgtcgaggaggagcggcccatccgactcatgctgggcacctgc
cccaccaaggaggacaaggaggccttcgccatcgtgtcggttcccgtgtccgagatccga
gacctggacttcgccaacgacgccagctccatgctggccagcgccgtggagaagctgcac
gagggcttcatcagccagaatgaccgcaggtttgttatccagctgctggaggacctggtg
ttttttgtcagtgatgtccccaacaatgggcagaatgtgctggacatcatggtcaccaag
cccaaccgcgagcggcagaagctgatgcgagagcagaacatcctcaaacagatcttcggc
attctgaaggccccgttccgtgacaaggggggcgagggccccctggtgcggctggaggag
ctgtcggaccagaagaacgcgccctaccagcacatgttccgcctgtgttaccgagtgctg
cgccattcccaggaggactaccgcaaaaaccaggagcacatcgccaagcagttcgggatg
atgcagtcccagattggctatgacatcctggccgaagacaccatcactgccttgctgcac
aacaaccgcaagctcctggagaagcacatcaccaaaacagaggtggagacctttgtcagc
ctggtgcggaagaaccgggagcccagattcctggactacctgtccgatctgtgtgtgtcc
aatcacatcgccatccccgtcacccaggagctcatctgcaagtgtgtgctggaccccaag
aacagcgacattctcatccagaccgagcttcggcccgtgaaggagatggcccagtcccac
gagtacctgagcatcgagtactcagaagaggaagtgtggctcacatggaccgacaagaac
aacgagcaccacgagaagagcgtccggcagctggctcaggaggcgcgggccggcaatgcc
cacgacgagaacgtgctcagctattacaggtaccagctgaagctcttcgcccgcatgtgc
ctggaccggcagtacctggccatcgacgagatctcccagcagctgggcgtcgacctcatc
ttcctgtgcatggcggacgagatgctgccctttgacctgcgcgcctccttctgccacctg
atgctccacgtgcacgtggaccgcgacccccaggagctggtcacacccgtcaagttcgcc
cgcctctggaccgagatccccacggccatcaccatcaaggactacgattccaacctcaat
gcctcccgagacgacaagaagaacaagttcgccagcaccatggagttcgtggaggactac
ctcaacaatgtggtcagcgaggccgtgcccttcgccaacgaggagaagaacaaactcacc
tttgaggtggtcagcctggcgcacaacctcatctactttggcttctacagcttcagcgag
ctgctgcggctcacgcgcactctgctgggcatcatcgactgcgtgcaggcctacgaggac
ccaggcggcaagaatgtgcggcggtccacccagggcgtggggcacatgatgtccaccatg
gtgctgaaccgcaagcagtctgtctttggtggccccagtttgcctgctggtgccggtgcc
cctgagccgctggacgggagcaagtttgaggagaatgaagacattgtggtgatggagacc
aagctgaagatcctggaaatactgcagttcatcctcaacgtccgcctggattaccgcatc
tcctacctgctgtccgtcttcaagaaggagttcgtggaggtgtttcccatgcaggacagt
ggggccgatggcacggcccctgccttcgactccaccaccgccaacatgaacctggaccgc
attggggagcaggcggaggccatgtttggagtggggaagaccagcagcatgctggaggtg
gatgacgagggtggccgcatgctgctgcgcgtgcttatccacctcaccatgcacgactat
gccccgctggtctcgggggccctgcagctgctcttcaagcacttcagccagcgccaggag
gtcatgcacaccttcaagcaggtgcagctgctgatctcagcccaggacgtggagaactac
aaggtgatcaagtccgagctggaccgactgcggaccatggtggagaagtcggagctgtgg
gtggacaagaagggcgccagcaagggcgaggagggggaggccggccctgctaaagacaag
aaggagcggcccacagatgaggagggctttctgcatccgcctggggagaagagcagcgag
aactaccagatcgtcaagggcatcctggagcggctgaacaagatgtgtggtgtgggggag
cagatgaggaagaaacagcagcggctactcaagaacatggacgcccacaaggtcatgctg
gacctgctgcagatcccctacgacaagggcgatgccaagatgatggagatcctgcgctac
acacaccagttcctgcagaagttctgcgcggggaaccccggcaaccaggccctgctacac
aagcacctgcacctcttcctgacgccagggctgctggaggcggagaccatgcagcacatc
ttcctgaacaactaccagctctgctccgagatcggggagcccgtcctgcagcacttcgtg
cacctgctggccacgcacgggcaccacgtgcagtacctggacttcctgcacaccgtcatc
aaggccgagggcaagtacgtcaagaagtgccaggacatgatcatgaccgagccggccaac
gcaggcgacgacgtggtcgtgttctacaacgacaaggcctcgctggcccacctgctggac
atgatgaaggctgcccgtgacggcgtggaggaccacagccccctcatgtaccacatctcc
ctggtggacctgctggctgcctgtgccgagggcaagaatgtatacaccgagatcaagtgc
acgtccctgctgcccctggaggatgtggtgtctgtggtgacacacgaggactgcatcacc
gaggtgaaaatggcctatgtgaatttcgtgaaccactgctacgtggacacggaggtggag
atgaaggagatctacaccagcaaccacatctggaccctctttgagaacttcaccctggac
atggctcgggtttgcagcaagcgtgagaagcgcctggctgaccccgccctggagaagtac
gtgctgaccgtcgtgctggacaccatcagtgccttcttcagctccccgttctctgagaac
agcacctccctgcagacgcaccagacgatcgtggtacagctgctgcagtccaccatgcgg
ctgctcgagtgtccgtggctgcagcagcagcacaagggctccgtggaggcctgcatccgg
accctcgccatggtggccaagggccgggccatctcgctgcccatggacttggatgcccac
atcagctcgctgctcagcagtggtgccagctgtgtggctgccgcccagcggaatgcctcc
aactacaagacggccacgcgggccttcccccgtgtcatgcctactgccaaccagtgggac
tacaagaacatcatcgagaagctgcaggacatcatcactgccctggaggagcggctgagg
cccctggtgcaggccgagctgtccgtgctggtggatgtcctgcactggcccgagctgctc
ttcctggagggcagtgacgcctaccagcgctgcgagagcgggggcttcctgtccaagctg
atccagcacaccaaggacctcatggagtcggaggagaagctgtgcgtcaaggtgctaagg
acgctgcagcagatgctgctgaagaagaccaagtatggggaccggggcaaccagctgcgc
aagatgctgctacaaaactacctccagaaccggaagtccagctcgaggggggacctcccg
gaccccatgggcaccggcctggaccaagactggtcagcaatcgcagccactcagtgccgg
ctggacaaggagggggccaccaagctggtgtgtgacctcatcaccagcaccaagaatgag
aagatcttccaggagagcatcggcctggccatccgcctgctggacggcggcaacaccgag
attcagaaatccttctacaacctgatgacgagcgacaagaagtcagagcgcttcttcaag
gtgctgcacgaccgcatgaagcgagcccagcaggagaccaagtccacggtggccgtcaac
atgagcgacctgggcagccagccgcgtgaggaccgtgagcaggcagaccccacctccaaa
ggccgcgtggcctccttctcgatgcccagctcctcatcccgctatgcgttgggccccagc
ctgcgccgggggcacgaggtgggcgaacgcgtgcagagcaacgagatgggcacgtccgtg
ctcatcatgcagcccatactgcgctttctgcagctgctgtgtgagaaccacaaccgggac
ctgcagaacttcctgcgctgccagaacaataagacaaactacaacctggtgtgcgagacg
ctgcagttcctggacatcatgtgcggcagcactacgggcggcctggggctgctggggctc
tacatcaatgaggacaacgtgggcctcgtcatccagaccctggagaccctcaccgagtac
tgtcagggtccctgccacgagaaccagacctgcatcgtgacgcacgagtccaacggcata
gacatcatcaccgcgctgattctcaatgacatcagccccctatgcaagtaccgtatggac
ctggtgctgcaactcaaggacaatgcctccaagctgctcctggctctgatggagagccgg
cacgacagtgaaaacgccgagcgcatcctcatcagcctgcggccccaggagctggtggac
gtcatcaagaaggcctacctgcaggaagaggagcgtgagaactcagacgtgagcccccgt
gaagtggggcacaacatctacatcctggcgctgcagctctccaggcacaacaagcagctg
cagcacctcctgaagcctgtgaagcgcatccaggaggaggaggccgagggcatctcttcc
atgctcagcctcaacaacaagcagctgacgcagatgctcaagtcctcagccccggtgcag
gagcaggaagaggaccctctggcctactatgagaaccacacctcccagatagagatcgtg
cggcaggaccgcagcatggagcagatcgtgttccccgtgcccggcatctgccagttcctg
acggaggagaccaagcaccgtctcttcaccaccaccgagcaggatgagcagggcagcaaa
gtgagcgacctcttcgaccagccctccttcctgcacaacgagatggagtggcagcgcaag
ctccgcagcatgccactcatctactggttctcccgccgcatgactctctggggcagcatc
tccttcaacctggcagtctttatcaacatcatcattgccttcttctacccctacgtggag
ggcgcgtccacaggcgtgctgggctccccgctcatctcactgctcttctggatcctcatc
tgcttctccatcgcggccctgttcaccaagcgctacagcgtccgccccctcatcgtggcg
ctcatcctgcgttccatctactacctgggcattgggcccacgctcaacatcctgggtgcc
ctcaacctgaccaacaagatcgtgttcgtggtgagctttgtgggcaaccgtggcaccttc
atccggggctataaggccatggtcatggacatggagttcctgtaccacgtgggctacatc
ctaacgagtgtcttgggcctcttcgcccacgagctcttctacagcatcctgctctttgac
ctcatctaccgcgaagagacgctgttcaacgtcatcaagagcgtgacccgcaacggccgc
tccatcctgctgaccgccctgctggccctcatcctggtctacctcttctccattgtcggc
ttcctcttcctcaaggacgacttcatccttgaggtggaccggctgcccggcaaccactcc
agagccaaccccctggggatgccacatggagctgccacatttgtgaacacgtgcagtggg
gacaacgtggactgtgtctcaggagtctctgtgcctgaggtcctggcagaggacgaggag
ccagacagcacggagcgggcctgtgacaccctgctcatgtgcatcgtcaccgtcatgaac
cacgggctgcgcaacggcggtggcgtgggggacatcctccgcaagccctccaaagacgag
tctctctttcccgcccgagtggtctacgacctcctgttcttcttcatcgtcatcatcatc
gtgctgaacctcatctttggggtgatcattgacacctttgccgacttgcgcagcgagaag
cagaagaaggaagagattctcaagaccacgtgcttcatctgcggtctggagagggacaag
tttgacaataagaccgtgtcatttgaggagcacatcaagtttgagcacaacatgtggaac
tacctgtacttcatcgtgctggtccgcgtgaagaacaagacggactacacggggccggag
agctacgtggcccagatgatcaagaacaagaacctggactggttcccccggatgcgggcc
atgtccctggtgagcagcgagggggaaggggagcagaacgagatccgcatcctccaggac
aagctcagcgccaccatgaagctggtgtcccacctcaccgcccagctcagcgagctcaag
gagcagatgacggagcagaggaaacgcaggcagcgcctgggctttgtggatgtgcagaac
tgcatgagccgctga

DBGET integrated database retrieval system