KEGG   Bos taurus (cow): 281941
Entry
281941            CDS       T01008                                 

Gene name
NCAM1
Definition
(RefSeq) neural cell adhesion molecule 1 precursor
  KO
K06491  neural cell adhesion molecule
Organism
bta  Bos taurus (cow)
Pathway
bta04514  Cell adhesion molecules
bta05020  Prion diseases
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    281941 (NCAM1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05020 Prion diseases
    281941 (NCAM1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:bta04131]
    281941 (NCAM1)
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:bta04515]
    281941 (NCAM1)
   04090 CD molecules [BR:bta04090]
    281941 (NCAM1)
   00536 Glycosaminoglycan binding proteins [BR:bta00536]
    281941 (NCAM1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
    281941 (NCAM1)
Membrane trafficking [BR:bta04131]
 Exocytosis
  Tethering complex
   Exocyst complex assembly proteins
    281941 (NCAM1)
Cell adhesion molecules [BR:bta04515]
 Immunoglobulin superfamily
  NCAM1/2
   281941 (NCAM1)
CD molecules [BR:bta04090]
 Proteins
  281941 (NCAM1)
Glycosaminoglycan binding proteins [BR:bta00536]
 Heparan sulfate / Haparin
  Adhesion molecules of cell surface
   281941 (NCAM1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:bta00537]
 Others
  281941 (NCAM1)
SSDB
Motif
Pfam: I-set Ig_3 ig Ig_2 fn3 V-set C2-set_2 Ig_5 Ig_4 C1-set Ig_6 Adeno_E3_CR1 Collagen_bind_2
Other DBs
NCBI-GeneID: 281941
NCBI-ProteinID: NP_776824
Ensembl: ENSBTAG00000005710
VGNC: 31898
UniProt: P31836
Position
15
AA seq 853 aa
MLQTKNLIWTLFFLGTAVSLQVDIVPSQGEISVGESKFFLCQVAGDAKDKDISWFSPNGE
KLTPNQQRISVVWNDDSSSTLTIYNANIDDAGIYKCVVTAEDGTESEATVNVKIFQKLMF
KNAPTPQEFREGEDAVIVCDVVSSLPPTIIWKHKGRDVILKKDVRFIVLTNNYLQIRGIK
KTDEGTYRCEGRILARGEINFKDIQVIVNVPPTVQARQSIVNATANLGQSVTLVCNAEGF
PEPTVSWTKDGEQIENEEDEKYLFSDDSSELTIRKVDKNDEAEYVCIAENKAGEQDASIH
LKVFAKPKITYVENQTAMELEEQVTLTCEASGDPIPSITWRTSTRNISSEEKASWTRPEK
QETLDGHMVVRSHARVSSLTLKSIQYTDAGEYVCTASNTIGQDSQSMYLEVQYAPKLQGP
VAVYTWEGNQVNITCEVFAYPSATISWFRDGQLLPSSNYSNIKIYNTPSASYLEVTPDSE
NDFGNYNCTAVNRIGQESLEFVLVQADTPSSPSIDQVEPYSSTAQVQFDEPEATGGVPIL
KYKAEWRAMGEEVWHXKWYDAKEASMEGIVTIVGLKPETTYAVRLAALNGKGLGEISAAS
EFKTQPVREPSAPKLEGQMGEDGNSIKVKLIKQDDGGSPIRHYLVKYRALSSEWKPEIRL
PSGSDHVMLKSLDWNAEYEVYVVAENQQGKSKAAHFVFRTSAQPTAIPANGSPTSGLSTG
AIVGILVVTFVLLLVAVDVTCYFLNKCGLLMCIAVNLCGKAGPGAKGKDMEEGKAAFSKD
ESKEPIVEVRTEEERTPNHDGGKHTEPNETTPLTEPEKGPVEAKPETETKPAPAEVQTVP
NDATQIKVNESKA
NT seq 2562 nt   +upstreamnt  +downstreamnt
atgctgcaaactaagaatctcatctggactttgtttttcctgggaactgcagtttctctg
caagtggatattgttcccagccaaggggaaatcagcgtgggagagtccaaattcttcctg
tgccaagtggccggagatgccaaagataaagacatctcctggttctcgcccaacggagag
aagctcaccccaaaccagcagcggatctcggtggtatggaacgatgactcctcctccacc
ctcaccatctacaacgccaacatcgatgatgccggcatctacaagtgtgtggtcactgcg
gaggatggcaccgagtcagaggccacggtcaacgtgaagatcttccagaagctcatgttc
aagaacgcgccaaccccacaggagttcagggagggagaagatgccgtgatcgtgtgtgat
gtggtcagctccctccccccaaccatcatctggaagcacaaaggccgagatgtcatcctg
aaaaaagatgtccgattcatagtcctgaccaacaactacctccagatccggggcatcaag
aaaacagatgagggcacttaccgctgtgagggcaggatccttgcccgcggggagatcaac
ttcaaggacattcaggtcatcgtgaatgtgccacccaccgtccaggccagacagagcatc
gtgaatgccaccgccaacctcggccagtccgtcaccctcgtgtgcaacgccgaaggcttc
ccagagcccaccgtgagctggacgaaggacggggagcagatagagaatgaggaggacgag
aagtacctgttcagcgacgacagctccgagctgaccatcaggaaggtggacaagaacgac
gaggctgagtacgtctgcattgccgagaacaaggcgggcgagcaggacgcgtccatccac
ctcaaggtcttcgcaaaacccaaaatcacctacgtagagaaccagactgccatggaactg
gaggaacaggtcactcttacctgtgaagcctcgggagaccccattccctcaatcacctgg
agaacatccacccgaaacatcagcagtgaagaaaaggcttcgtggactcgaccagagaag
caagagaccctggacgggcacatggtggtgcgcagccacgcccgcgtgtcgtccctgacg
ctgaagagcatccagtacaccgacgccggggagtatgtctgcactgccagcaacaccatc
ggccaggactcccagtccatgtacctcgaagtgcaatatgcccccaagctgcagggccct
gtggctgtgtacacttgggaggggaaccaggtgaacatcacctgcgaggtgtttgcctac
cccagtgccactatctcgtggttccgagacggtcagctgctgcccagctccaactacagc
aacatcaagatctacaacaccccgtccgccagctacctggaggtgaccccagactctgaa
aatgattttggaaactacaactgtaccgcagtgaaccgcatcggacaggagtctttggaa
ttcgtccttgtccaagcagatactccatcctcaccatccatcgaccaggtggagccatac
tctagcacagcacaggtgcaatttgatgagccagaggccacaggcggagtgcccatcctc
aaatacaaagctgagtggagagcaatgggcgaggaggtgtggcactncaagtggtatgat
gccaaggaagccagcatggagggcattgtcaccatcgtgggcctcaagcccgagacgacg
tacgcagtccggctggcggccctcaacggcaagggcctgggcgagatcagcgccgcctct
gagttcaagacgcagccagtccgggaacccagtgcacctaagctcgaagggcagatggga
gaggatggaaactctattaaggtgaagctgatcaagcaagacgacggcggctcccccatc
cgacactacctggtcaaataccgagcgctctcctccgagtggaaaccagagatcaggctc
ccgtctggcagtgaccacgtcatgctcaagtccctggactggaatgccgagtacgaggtc
tatgtggtggccgagaaccagcagggcaagtccaaagcggcgcactttgtgttcaggacc
tcggcccagcccacagccatcccagccaacggcagccccacctcgggcctgagcactggc
gccatcgtgggcatcctcgtcgtgaccttcgtcctgctcctggtggccgtggacgtcacc
tgctacttcctgaacaagtgtggcctgctcatgtgcattgccgtcaacttgtgtggcaaa
gccgggcccggagccaagggcaaggacatggaggagggcaaagcggccttctcgaaagat
gagtccaaggagcctatcgtggaggtgcgaacggaggaggagcggaccccgaatcacgac
ggagggaaacacacggagccgaacgagaccacgccgctgacggagcccgagaagggtccc
gtagaagcaaagccggagacagaaacgaagcctgcgccagccgaagtccagacggtcccc
aacgatgccacacaaataaaggtgaatgagagcaaagcgtga

DBGET integrated database retrieval system