KEGG   Bos taurus (cow): 281964
Entry
281964            CDS       T01008                                 

Symbol
PAG1
Name
(RefSeq) pregnancy-associated glycoprotein 1 precursor
  KO
K06002  pepsin A [EC:3.4.23.1]
Organism
bta  Bos taurus (cow)
Pathway
bta04974  Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09154 Digestive system
   04974 Protein digestion and absorption
    281964 (PAG1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bta01002]
    281964 (PAG1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.1  pepsin A
     281964 (PAG1)
Peptidases and inhibitors [BR:bta01002]
 Aspartic peptidases
  Family A1: pepsin family
   281964 (PAG1)
SSDB
Motif
Pfam: Asp TAXi_N A1_Propeptide Asp_protease_2
Other DBs
NCBI-GeneID: 281964
NCBI-ProteinID: NP_776836
Ensembl: ENSBTAG00000037908
UniProt: Q29432
Position
29:complement(38604865..38614193)
AA seq 380 aa
MKWLVLLGLVAFSECIVKIPLRRLKTMRNVVSGKNMLNNFLKEHAYSLSQISFRGSNLTT
HPLRNIKDLVYMGNITIGTPPQEFQVVFDTASSDLWVPSDFCTSPACSTHVRFRHLQSST
FRLTNKTFRITYGSGRMKGVVVHDTVRIGNLVSTDQPFGLSIEEYGFEGRIYDGVLGLNY
PNISFSGAIPIFDKLKNQRAISEPVFAFYLSKDEREGSVVMFGGVDHRYYEGELNWVPLI
QAGDWSVHMDRISIERKIIACSDGCKALVDTGTSDIVGPRRLVNNIHRLIGAIPRGSEHY
VPCSEVNTLPSIVFTINGINYPVPGRAYILKDDRGRCYTTFQENRVSSSTETWYLGDVFL
RLYFSVFDRGNDRIGLARAV
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgaagtggcttgtgctcctcgggctggtggccttctcagagtgcatagtcaaaatacct
ctaaggagactgaagaccatgagaaatgtcgtcagtggaaaaaacatgctgaacaatttt
ctgaaggagcatgcttacagtctgtcccagatttcttttcgtggctcaaatctaactact
cacccgctgagaaacatcaaggatttggtctacatgggtaacatcaccattggaacaccc
cctcaggaattccaggttgtctttgacacagcctcatctgacttgtgggtgccctccgac
ttttgcactagtccagcctgttctacacacgttaggttcagacatcttcagtcttccact
ttccggcttaccaataagaccttcaggatcacctatggatctgggagaatgaaaggagtt
gttgttcatgacacagttcggattgggaaccttgtaagtactgaccagccatttggtcta
agcattgaggaatacgggtttgagggcagaatttatgatggtgtcttgggcttgaactac
cccaacatatccttctctggagccatccccatctttgacaagctgaagaatcaacgtgcc
atttctgagcctgtttttgccttctacttgagcaaagatgagcgggagggcagtgtggtg
atgtttggtggggtggaccaccgctattatgagggagagctcaactgggtacccctgatc
caagcaggcgactggagtgtacacatggaccgcatctccattgaaagaaagattattgct
tgttctgatggctgcaaggcccttgtggacaccgggacatcagatatcgtaggtccaaga
agactggtcaataacatccataggctcatcggtgccataccacggggttccgagcactac
gttccatgttctgaggtcaataccctgccctctattgtcttcaccatcaacggcatcaac
tacccagtgccaggtcgagcctacatcctcaaggatgatagaggccgctgctataccacc
tttcaagagaaccgagtgagttcatctacagagacctggtacctgggtgacgtcttcctg
agactgtatttctcggtctttgatcgaggaaatgacagaattggcctggcacgggcagtg
taa

DBGET integrated database retrieval system