KEGG   Bos taurus (cow): 281969
Entry
281969            CDS       T01008                                 
Symbol
PDE1A
Name
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1A
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta01100  Metabolic pathways
bta04020  Calcium signaling pathway
bta04740  Olfactory transduction
bta04742  Taste transduction
bta04924  Renin secretion
bta05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    281969 (PDE1A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    281969 (PDE1A)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    281969 (PDE1A)
  09157 Sensory system
   04740 Olfactory transduction
    281969 (PDE1A)
   04742 Taste transduction
    281969 (PDE1A)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    281969 (PDE1A)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     281969 (PDE1A)
SSDB
Motif
Pfam: PDEase_I PDEase_I_N
Other DBs
NCBI-GeneID: 281969
NCBI-ProteinID: NP_776839
BGD-bta: BT12562
Ensembl: ENSBTAG00000012100
VGNC: 32671
UniProt: P14100
Position
2:14055658..14453677
AA seq 514 aa
MDDHVTIRRKHLQRPIFRLRCLVKQLEKGDVNVIDLKKNIEYAASVLEAVYIDETRRLLD
TDDELSDIQSDSVPSEVRDWLASTFTRKMGMMKKKSEEKPRFRSIVHVVQAGIFVERMYR
KSYHMVGLAYPEAVIVTLKDVDKWSFDVFALNEASGEHSLKFMIYELFTRYDLINRFKIP
VSCLIAFAEALEVGYSKYKNPYHNLIHAADVTQTVHYIMLHTGIMHWLTELEILAMVFAA
AIHDYEHTGTTNNFHIQTRSDVAILYNDRSVLENHHVSAAYRLMQEEEMNVLINLSKDDW
RDLRNLVIEMVLSTDMSGHFQQIKNIRNSLQQPEGLDKAKTMSLILHAADISHPAKSWKL
HHRWTMALMEEFFLQGDKEAELGLPFSPLCDRKSTMVAQSQIGFIDFIVEPTFSLLTDST
EKIIIPLIEEDSKTKTPSYGASRRSNMKGTTNDGTYSPDYSLASVDLKSFKNSLVDIIQQ
NKERWKELAAQGEPDPHKNSDLVNAEEKHAETHS
NT seq 1545 nt   +upstreamnt  +downstreamnt
atggatgaccatgtcacaatcaggaggaaacatctccaaagacccatctttagactaaga
tgcttagtgaagcagctggaaaaaggtgatgttaacgtcatcgacttaaagaagaatatt
gaatatgcagcatctgtgttggaagcagtttatattgatgaaacaaggagactgctggac
accgatgatgagctcagtgacattcagtcggattccgtcccatcagaagtccgggactgg
ttggcttctacctttacacggaaaatggggatgatgaaaaagaaatctgaggaaaaacca
agatttcggagcattgtgcatgttgttcaagctggaatttttgtggaaagaatgtacaga
aagtcctatcacatggttggcttggcatatccagaggctgtcatagtaacattaaaggat
gttgataaatggtcttttgatgtatttgccttgaatgaagcaagtggagaacacagtctg
aagtttatgatttatgaactattcaccagatatgatcttatcaaccgtttcaagattcct
gtttcttgcctaattgcctttgcagaagctctagaagttggttacagcaagtacaaaaat
ccataccacaatttgattcatgcagctgatgtcactcaaactgtgcattacataatgctt
catacaggtatcatgcactggctcactgaactggaaattttagcaatggtctttgccgct
gccattcatgactatgagcatacagggactacaaacaattttcacattcagacaaggtca
gatgttgccattttgtataatgatcgctctgtccttgaaaatcatcatgtgagtgcagct
tatcgccttatgcaagaagaagaaatgaatgtcctgataaatttatccaaagatgactgg
agggatcttcggaacctagtgattgaaatggtgttgtctacagacatgtcgggtcacttc
cagcaaattaaaaatataagaaatagtttgcagcaacctgaagggcttgacaaagccaaa
accatgtccctgattctccatgcagcagacatcagtcacccagccaaatcctggaagctg
caccaccgatggaccatggccctaatggaggagtttttcctacagggagataaagaagct
gaattagggcttccattttccccgctttgcgatcggaagtcaacgatggtggcccagtcc
caaataggtttcattgatttcatagtagaaccaacattttctcttctgacagactcaaca
gagaaaattattattcctcttatagaggaagactcgaaaaccaaaactccttcctatgga
gcaagcagacgatcaaatatgaaaggcaccaccaatgatggaacctactcccccgactac
tcccttgccagcgtggacctgaagagcttcaaaaacagcctggtggacatcatccagcag
aacaaagagaggtggaaagagttagctgctcaaggtgaacctgatccccataagaactca
gatctagtaaatgctgaagaaaaacatgctgaaacacattcatag

DBGET integrated database retrieval system