KEGG   Bos taurus (cow): 281970Help
Entry
281970            CDS       T01008                                 

Gene name
PDE1B
Definition
(RefSeq) calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase 1B
  KO
K13755  calcium/calmodulin-dependent 3',5'-cyclic nucleotide phosphodiesterase [EC:3.1.4.17]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta04020  Calcium signaling pathway
bta04740  Olfactory transduction
bta04742  Taste transduction
bta04924  Renin secretion
bta05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    281970 (PDE1B)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    281970 (PDE1B)
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    281970 (PDE1B)
  Sensory system
   04740 Olfactory transduction
    281970 (PDE1B)
   04742 Taste transduction
    281970 (PDE1B)
 Human Diseases
  Substance dependence
   05032 Morphine addiction
    281970 (PDE1B)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.17  3',5'-cyclic-nucleotide phosphodiesterase
     281970 (PDE1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I PDEase_I_N
Motif
Other DBs
NCBI-GeneID: 281970
NCBI-ProteinID: NP_776840
BGD-bta: BT15048
Ensembl: ENSBTAG00000004337
VGNC: 32672
UniProt: Q01061
Position
5
AA seq 534 aa AA seqDB search
MELSPRSPPEMLESDCPSPLELKSAPSKKMWIKLRSLLRYMVKQLENGEVNIEELKKNLE
YTASLLEAVYIDETRQILDTEDELQELRSDAVPSEVRDWLASTFTQQTRAKGPSEEKPKF
RSIVHAVQAGIFVERMFRRTYTSVGPTYSTAVLNCLKNVDLWCFDVFSLNRAADDHALRT
IVFELLTRHNLISRFKIPTVFLMTFLDALETGYGKYKNPYHNQIHAADVTQTVHCFLLRT
GMVHCLSEIEVLAIIFAAAIHDYEHTGTTNSFHIQTKSECAILYNDRSVLENHHISSVFR
MMQDDEMNIFINLTKDEFVELRALVIEMVLATDMSCHFQQVKSMKTALQQLERIDKSKAL
SLLLHAADISHPTKQWSVHSRWTKALMEEFFRQGDKEAELGLPFSPLCDRTSTLVAQSQI
GFIDFIVEPTFSVLTDVAEKSVQPTGDDDSKSKNQPSFQWRQPSLDVEVGDPNPDVVSFR
STWTKYIQENKQKWKERAASGITNQMSIDELSPCEEEAPASPAEDEHNQNGNLD
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atggagctgtccccccgcagccctcccgagatgctagagtcggactgcccttcacccctg
gagctgaagtcagcccccagcaagaagatgtggattaagctccggtctctgctgcgctac
atggtgaagcagttggagaacggggaggtaaacattgaggagctgaagaaaaacctggag
tacacagcttctctgctggaggccgtctatatagatgagactcggcaaatcctggacacg
gaggatgagctgcaggagctgcggtctgatgcggtgccttcagaggtgcgggactggctg
gcctccaccttcacccagcagacccgggccaaaggcccgagcgaagagaagcccaagttc
cggagcatcgtgcacgcggtgcaggctggcatctttgtggagcggatgttccggagaacg
tacacctctgtgggccccacctactccactgccgtcctcaactgtctcaagaacgtggac
ctttggtgctttgatgtcttttccttgaaccgggcagcagatgaccacgccctgaggacc
atcgtttttgagctgctgactcggcacaacctcatcagccgctttaagattcccactgtg
tttttgatgactttcctggatgccttggagacaggctacggaaagtacaagaacccttac
cacaaccagatccacgcagctgacgtcacccagacggtccactgcttcttgctccgcaca
gggatggtgcactgcctgtcggagattgaggtcctggccatcatctttgctgcagccatc
cacgactatgagcacactggcactaccaacagcttccacatccagaccaaatcggaatgc
gccatcctgtacaacgaccgctcagtgctggagaatcaccacatcagctcggttttccga
atgatgcaggacgacgagatgaacatcttcatcaacctcaccaaggatgagtttgtagag
ctgcgggctctggtcattgagatggtgttggccacagacatgtcctgccatttccagcaa
gtgaagtccatgaagacagccttgcagcagctggagaggattgacaagtccaaggccctc
tctctgctgcttcatgctgctgacatcagccaccccaccaagcagtggtcggttcacagc
cgctggaccaaggccctcatggaggaattcttccgccagggtgacaaggaggctgagctg
ggcctgcccttttctccgctctgtgaccgcacttccaccctcgtggcgcagtcccagatt
ggtttcatcgacttcattgtggagcccacgttctctgtgctcaccgatgtggctgagaag
agtgtccagcccaccggggacgacgactcgaagtctaaaaaccagcccagcttccagtgg
cgccagccttctctggatgtagaagtgggagaccccaaccctgacgtggtcagcttccgc
tccacctggaccaaatacattcaggagaacaagcagaaatggaaggaacgggcggcgagc
ggcatcaccaaccagatgtccattgacgaactgtccccttgtgaggaagaggccccagcc
tcccctgccgaagacgagcacaaccagaacgggaatctggactag

DBGET integrated database retrieval system