KEGG   Bos taurus (cow): 281972
Entry
281972            CDS       T01008                                 

Gene name
PDE5A
Definition
(RefSeq) cGMP-specific 3',5'-cyclic phosphodiesterase
  KO
K13762  cGMP-specific 3',5'-cyclic phosphodiesterase [EC:3.1.4.35]
Organism
bta  Bos taurus (cow)
Pathway
bta00230  Purine metabolism
bta01100  Metabolic pathways
bta04022  cGMP-PKG signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    281972 (PDE5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    281972 (PDE5A)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     281972 (PDE5A)
SSDB
Motif
Pfam: PDEase_I GAF GAF_2 HD
Other DBs
NCBI-GeneID: 281972
NCBI-ProteinID: NP_776842
BGD-bta: BT10779
Ensembl: ENSBTAG00000024888
VGNC: 32678
UniProt: Q28156
Structure
PDB: 
3JBQ 3JAB

Position
6
AA seq 865 aa
MERAGPGSARPQQQWDQDSVEAWLDDHWDFTFSYFVRKGTREMVNAWFAERVHTIPVCKE
GIKGHTESCSCPLQPSPRAESSVPGTPTRKISASEFDRPLRPIVIKDSEGTVSFLSDSDK
KEQMPLTSPRFDNDEGDQCSRLLELVKDISSHLDVTALCHKIFLHIHGLISADRYSLFLV
CEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGHVAAFGEPLNIKDAYEDPR
FNAEVDQITGYKTQSILCMPIKNHREEVVGVAQAINKKSGNGGTFTEKDEKDFAAYLAFC
GIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILKKIAATIISFMQVQKCTIF
IVDEDCSDSFSSVFHMECEELEKSSDTLTRERDANRINYMYAQYVKNTMEPLNIPDVSKD
KRFPWTNENMGNINQQCIRSLLCTPIKNGKKNKVIGVCQLVNKMEETTGKVKAFNRNDEQ
FLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASAAEEETRELQSLAAAVVPS
AQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKHEVLCKWILSVKKNYRKNV
AYHNWRHAFNTAQCMFAALKAGKIQKRLTDLEILALLIAALSHDLDHRGVNNSYIQRSEH
PLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTTLKIIKQAILATDLALYIK
RRGEFFELIMKNQFNLEDPHQKELFLAMLMTACDLSAITKPWPIQQRIAELVATEFFDQG
DRERKELNIEPADLMNREKKNKIPSMQVGFIDAICLQLYEALTHVSEDCFPLLDGCRKNR
QKWQALAEQQEKTLINGESSQTKRN
NT seq 2598 nt   +upstreamnt  +downstreamnt
atggagagggccggccccggctccgcgcggccgcaacagcaatgggaccaggactcggtc
gaagcgtggctggacgatcactgggactttaccttctcttactttgttaggaaaggcacc
agagaaatggtcaacgcatggtttgctgagagagttcacaccattcctgtgtgcaaggaa
ggaatcaagggccacacggaatcctgctcttgccccttgcagccaagtccccgtgcagag
agcagtgtccctggaacaccaaccaggaagatctctgcctctgaattcgatcggccgctt
agacccatcgttatcaaggattctgagggaactgtgagcttcctctctgactcagacaag
aaggaacagatgcctctaacctccccacggtttgataatgatgaaggggaccagtgctcg
agactcttggaattagtgaaagatatttctagtcacttggatgtcacagccttatgtcac
aaaattttcttgcacatccatggactcatctccgccgaccgctactccttattcctcgtc
tgtgaggacagctccaacgacaagtttcttatcagccgcctctttgatgttgcagaaggt
tcaacactggaagaagcttcaaacaactgcatccgcttagagtggaacaaaggcatcgtg
ggacacgtggccgcttttggcgagcccttgaacatcaaagacgcctatgaggatcctcga
ttcaatgcagaagttgaccaaattacaggctacaagacacaaagtattctttgtatgcca
attaagaatcatagggaagaggttgttggtgtagcccaggccatcaacaagaaatcagga
aatggtgggacattcactgaaaaagacgaaaaggactttgctgcttacttggcattttgt
ggaattgttcttcataatgctcaactctatgagacttcactgctggagaacaagagaaat
caggtgctgcttgaccttgctagcttaatttttgaagaacaacaatcattagaagtaatt
ctaaagaaaatagctgccactattatctctttcatgcaggtgcagaaatgcaccattttc
atagtggatgaagattgctccgattctttttctagtgtgtttcacatggagtgtgaggaa
ttagaaaaatcgtcagatactttaacacgggaacgtgatgcaaacagaatcaattacatg
tatgctcagtatgtcaaaaataccatggaaccacttaatatcccagacgtcagtaaggac
aaaagatttccctggacaaatgaaaacatgggaaatataaaccagcagtgcattagaagt
ttgctttgtacacctataaaaaatggaaagaagaacaaagtgataggggtttgccaactt
gttaataagatggaggaaaccactggcaaagttaaggctttcaaccgcaacgatgaacag
tttctggaagctttcgtcatcttttgtggcttggggatccagaacacacagatgtacgaa
gcagtggagagagccatggccaagcaaatggtcacgttagaggttctgtcttatcatgct
tcagctgcagaggaagaaaccagagagctgcagtccttagcggctgctgtggtaccatct
gcccagacccttaaaatcactgacttcagcttcagcgactttgagctgtctgacctggaa
acagcactgtgcacaatccggatgttcactgacctcaaccttgtgcagaacttccagatg
aaacatgaggtcctttgcaagtggattttaagtgtgaagaagaactatcggaagaacgtc
gcctatcataattggagacatgcctttaatacagctcagtgcatgtttgcggcactaaaa
gcaggcaaaattcagaagaggctgacggacctggagatacttgcactgctgattgctgcc
ttaagccatgatctggatcaccgtggtgtcaataactcatacatacagcgaagtgaacac
ccacttgctcagctctactgccattcaatcatggagcatcatcattttgatcagtgcctg
atgatccttaatagtcctggcaatcagattctcagtggcctctccattgaagagtataag
accaccctgaagatcatcaagcaagctattttagccacagacctagcactgtacataaag
agacgaggagaattttttgaacttataatgaaaaatcaattcaatttggaagatcctcat
caaaaggagttgtttttagcgatgctgatgacagcttgtgatctttctgcaattacaaaa
ccctggcctattcaacaacggatagcagaacttgttgccactgaattttttgaccaagga
gatagagagaggaaagaactcaacatagagcccgctgatctaatgaaccgggagaagaaa
aacaaaatcccaagtatgcaagttggattcatagatgccatctgcttgcaactgtatgag
gccttgacccatgtgtcggaggactgtttccctttgctggacggctgcagaaagaacagg
cagaaatggcaggctcttgcagaacagcaggagaagacactgatcaatggtgaaagcagc
cagaccaagcggaactga

DBGET integrated database retrieval system