KEGG   Bos taurus (cow): 281987Help
Entry
281987            CDS       T01008                                 

Gene name
PLCG1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1
  KO
K01116  phosphatidylinositol phospholipase C, gamma-1 [EC:3.1.4.11]
Organism
bta  Bos taurus (cow)
Pathway
bta00562  Inositol phosphate metabolism
bta01100  Metabolic pathways
bta01521  EGFR tyrosine kinase inhibitor resistance
bta04012  ErbB signaling pathway
bta04014  Ras signaling pathway
bta04015  Rap1 signaling pathway
bta04020  Calcium signaling pathway
bta04064  NF-kappa B signaling pathway
bta04066  HIF-1 signaling pathway
bta04070  Phosphatidylinositol signaling system
bta04072  Phospholipase D signaling pathway
bta04360  Axon guidance
bta04370  VEGF signaling pathway
bta04650  Natural killer cell mediated cytotoxicity
bta04658  Th1 and Th2 cell differentiation
bta04659  Th17 cell differentiation
bta04660  T cell receptor signaling pathway
bta04664  Fc epsilon RI signaling pathway
bta04666  Fc gamma R-mediated phagocytosis
bta04670  Leukocyte transendothelial migration
bta04722  Neurotrophin signaling pathway
bta04750  Inflammatory mediator regulation of TRP channels
bta04919  Thyroid hormone signaling pathway
bta04933  AGE-RAGE signaling pathway in diabetic complications
bta05167  Kaposi's sarcoma-associated herpesvirus infection
bta05169  Epstein-Barr virus infection
bta05200  Pathways in cancer
bta05205  Proteoglycans in cancer
bta05206  MicroRNAs in cancer
bta05214  Glioma
bta05223  Non-small cell lung cancer
bta05225  Hepatocellular carcinoma
bta05231  Choline metabolism in cancer
Module
bta_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:bta00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    281987 (PLCG1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    281987 (PLCG1)
   04015 Rap1 signaling pathway
    281987 (PLCG1)
   04012 ErbB signaling pathway
    281987 (PLCG1)
   04370 VEGF signaling pathway
    281987 (PLCG1)
   04064 NF-kappa B signaling pathway
    281987 (PLCG1)
   04066 HIF-1 signaling pathway
    281987 (PLCG1)
   04020 Calcium signaling pathway
    281987 (PLCG1)
   04070 Phosphatidylinositol signaling system
    281987 (PLCG1)
   04072 Phospholipase D signaling pathway
    281987 (PLCG1)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    281987 (PLCG1)
   04660 T cell receptor signaling pathway
    281987 (PLCG1)
   04658 Th1 and Th2 cell differentiation
    281987 (PLCG1)
   04659 Th17 cell differentiation
    281987 (PLCG1)
   04664 Fc epsilon RI signaling pathway
    281987 (PLCG1)
   04666 Fc gamma R-mediated phagocytosis
    281987 (PLCG1)
   04670 Leukocyte transendothelial migration
    281987 (PLCG1)
  Endocrine system
   04919 Thyroid hormone signaling pathway
    281987 (PLCG1)
  Nervous system
   04722 Neurotrophin signaling pathway
    281987 (PLCG1)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    281987 (PLCG1)
  Development
   04360 Axon guidance
    281987 (PLCG1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    281987 (PLCG1)
   05231 Choline metabolism in cancer
    281987 (PLCG1)
   05206 MicroRNAs in cancer
    281987 (PLCG1)
   05205 Proteoglycans in cancer
    281987 (PLCG1)
   05225 Hepatocellular carcinoma
    281987 (PLCG1)
   05214 Glioma
    281987 (PLCG1)
   05223 Non-small cell lung cancer
    281987 (PLCG1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    281987 (PLCG1)
  Infectious diseases
   05167 Kaposi's sarcoma-associated herpesvirus infection
    281987 (PLCG1)
   05169 Epstein-Barr virus infection
    281987 (PLCG1)
  Drug resistance
   01521 EGFR tyrosine kinase inhibitor resistance
    281987 (PLCG1)
Enzymes [BR:bta01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     281987 (PLCG1)
Membrane trafficking [BR:bta04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    281987 (PLCG1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    281987 (PLCG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X SH2 PI-PLC-Y SH3_1 C2 PH SH3_9 SH3_2 PH_12 GDPD
Motif
Other DBs
NCBI-GeneID: 281987
NCBI-ProteinID: NP_776850
BGD-bta: BT10117
Ensembl: ENSBTAG00000017584
VGNC: 32988
UniProt: P08487
Structure
PDB: 

Position
13
AA seq 1291 aa AA seqDB search
MAGAASPCANGCGPSAPSDAEVVHLCRSLEVGTVMTLFYSKKSQRPERKTFQVKLETRQI
TWSRGADKIEGAIDIREIKEIRPGKTSRDFDRYQEDPAFRPDQSHCFVILYGMEFRLKTL
SLQATSEDEVNMWIRGLTWLMEDTLQAATPLQIERWLRKQFYSVDRNREDRISAKDLKNM
LSQVNYRVPNMRFLRERLTDLEQRTSDITYGQFAQLYRSLMYSAQKTMDLPFLEASALRA
GERPELCRVSLPEFQQFLLEYQGELWAVDRLQVQEFMLSFLRDPLREIEEPYFFLDEFVT
FLFSKENSIWNSQLDEVCPDTMNNPLSHYWISSSHNTYLTGDQFSSESSLEAYARCLRMG
CRCIELDCWDGPDGMPVIYHGHTLTTKIKFSDVLHTIKEHAFVASEYPVILSIEDHCSIA
QQRNMAQYFKKVLGDTLLTKPVDIAADGLPSPNQLKRKILIKHKKLAEGSAYEEVPTSVM
YSENDISNSIKNGILYLEDPVNHEWYPHYFVLTSSKIYYSEETSSDQGNEDEEEPKEASG
STELHSNEKWFHGKLGAGRDGRHIAERLLTEYCIETGAPDGSFLVRESETFVGDYTLSFW
RNGKVQHCRIHSRQDAGTPKFFLTDNLVFDSLYDLITHYQQVPLRCNEFEMRLSEPVPQT
NAHESKEWYHASLTRAQAEHMLMRVPRDGAFLVRKRNEPNSYAISFRAEGKIKHCRVQQE
GQTVMLGNSEFDSLVDLISYYEKHPLYRKMKLRYPINEEALEKIGTAEPDYGALYEGRNP
GFYVEANPMPTFKCAVKALFDYKAQREDELTFTKSAIIQNVEKQEGGWWRGDYGGKKQLW
FPSNYVEEMVSPAALEPEREHLDENSPLGDLLRGVLDVPACQIAVRPEGKNNRLFVFSIS
MASVAHWSLDVAADSQEELQDWVKKIREVAQTADARLTEGKMMERRKKIALELSELVVYC
RPVPFDEEKIGTERACYRDMSSFPETKAEKYVNKAKGKKFLQYNRLQLSRIYPKGQRLDS
SNYDPLPMWICGSQLVALNFQTPDKPMQMNQALFLAGGHCGYVLQPSVMRDEAFDPFDKS
SLRGLEPCAICIEVLGARHLPKNGRGIVCPFVEIEVAGAEYDSIKQKTEFVVDNGLNPVW
PAKPFHFQISNPEFAFLRFVVYEEDMFSDQNFLAQATFPVKGLKTGYRAVPLKNNYSEGL
ELASLLVKIDVFPAKQENGDLSPFGGASLRERSCDASGPLFHGRAREGSFEARYQQPFED
FRISQEHLADHFDGRDRRTPRRTRVNGDNRL
NT seq 3876 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcgccgcgtccccctgcgccaacggctgcgggcccagtgcgccctcggacgcc
gaggtggtgcacctctgccgcagcctcgaggtgggcaccgtcatgactttgttctactcc
aagaagtcgcagcggcccgagcggaagaccttccaggtcaagctggagacgcggcagatc
acgtggagccgaggcgccgacaagatagagggggccattgacattcgtgaaatcaaggag
atccgcccagggaagacctcacgggacttcgatcgctaccaagaggatcctgcttttcga
ccggaccagtcccactgcttcgtcatcctgtatggaatggaattccgcctgaagaccctg
agcctccaagccacgtctgaggacgaagtgaacatgtggatcaggggcctgacttggctg
atggaggacacgttgcaggcagccacacccctgcagattgagaggtggctgcggaagcag
ttctactcagtggaccggaaccgtgaggaccggatatcggccaaggacctgaagaacatg
ctgtcccaggtcaactaccgggtccccaacatgcgcttcctccgggagcggctgacggac
ctggagcagcgcaccagtgacatcacctacgggcagtttgcacagctgtaccgcagcctc
atgtacagcgcccagaagacgatggaccttcctttcctggaagccagcgccctgagggcg
ggggagcggccggagctgtgccgggtgtcccttcctgagttccagcagttcctcctcgag
taccaaggggagctgtgggcggtggaccggctccaggtgcaggagttcatgctcagcttc
ctccgagaccccttgcgagagattgaggagccttacttcttcctggacgagttcgtcacc
ttcctgttctccaaggagaacagcatatggaactcgcagctagacgaggtgtgccccgac
accatgaacaaccccctgtcccactactggatctcctcctcgcacaacacgtacctgacc
ggggaccagttctccagcgagtcctccctggaagcctacgctcgctgcctgcggatgggc
tgccgttgcattgagttggactgctgggacggcccggatgggatgccggtcatttaccat
ggacacactctgaccaccaagatcaagttctcagacgtcctgcacaccatcaaggagcac
gcctttgtggcctcagagtacccggtcatcctgtccatcgaggaccactgcagcattgcc
cagcagaggaacatggcccagtatttcaaaaaggtgcttggggacacactcctcaccaag
cccgtggatattgcagccgacgggctcccctcccccaaccagctcaagaggaagatcctt
atcaagcacaagaagttggctgagggcagtgcctacgaggaggtgccaacatcggtgatg
tactctgagaacgacatcagcaactccatcaagaatggcatcctctacctggaagaccct
gtgaaccatgagtggtacccccactacttcgtcctgaccagcagcaagatctactactcg
gaggagaccagcagcgaccagggcaacgaggatgaggaggagcccaaggaggccagtggc
agcacagagctgcactccaacgagaagtggttccacgggaagcttggggcgggccgggat
gggcggcacatcgccgagcgcctgctcacggagtactgcattgagaccggggcccccgac
ggctccttccttgtgcgcgagagcgagacctttgtgggcgactacactctgtccttctgg
cggaatggcaaagtgcagcactgccggatccactcccggcaggacgcaggcacccccaag
ttcttcctgacggacaacctcgtcttcgactccctctatgacctcatcacgcactaccag
caggtgcccctgcgctgcaacgaatttgagatgcgcctctcagagccggtcccgcagacc
aacgcgcacgagagcaaagagtggtaccacgccagcctgaccagagcgcaggccgagcac
atgctgatgcgtgtacccagggacggggccttcctggtgcggaaacggaacgagcccaac
tcctacgccatctccttccgggctgagggcaagatcaagcactgccgcgtccagcaggag
ggccagaccgtgatgctgggcaactcagagtttgacagccttgtcgacctcatcagctac
tacgagaagcacccactgtaccgcaagatgaagctgcgctaccccatcaacgaggaggct
ctggagaagatcggcacagctgagcctgactacggcgcgctgtacgagggccgcaaccct
ggcttctatgtggaggcgaaccccatgcccacgttcaagtgcgccgtcaaagctctcttc
gactacaaagcgcagcgggaggacgagctgacattcaccaagagtgccatcatccagaac
gtggagaagcaggagggaggctggtggcggggtgactacggcgggaagaagcagctgtgg
ttcccttcaaactatgtggaggaaatggtcagcccggcggccctggagcccgagagggag
cacttggacgagaacagcccactcggggacttgctccggggggtcctggatgtgccagct
tgtcagatagccgtccgtcccgagggcaagaacaaccggctgttcgtcttctccatcagc
atggcctcggtggcacactggtccctggatgtggctgccgactcgcaggaagagctgcag
gactgggtgaagaagatccgggaggtggcgcagacagcggatgccaggctcaccgagggc
aagatgatggagcggaggaagaagatcgccctagagctctcagagctcgtcgtctactgc
cggcctgtccctttcgacgaagagaagattggcaccgaacgggcctgctaccgcgacatg
tcgtccttcccggagaccaaggccgagaagtacgtgaacaaggccaaaggcaagaagttc
ctccagtacaaccgcctgcagctctcccgcatctaccctaagggccagcggctggactcc
tccaattacgaccccctgcccatgtggatctgcggcagccagcttgtggccctcaacttc
cagaccccagacaaacccatgcagatgaaccaggccctgttcctggccggcgggcactgt
ggctatgtgctgcagcccagcgtcatgcgcgatgaggccttcgatccctttgacaagagc
agcctccgcgggctggagccgtgcgccatctgcatcgaggtgctgggggcccggcacctg
ccgaagaacggccgaggcatcgtgtgtccttttgtggagatcgaggtggccggagccgag
tatgacagcatcaagcagaagacagagtttgtggtggacaatggactgaaccccgtgtgg
ccagccaagcccttccacttccagattagtaaccccgagttcgccttcctgcgcttcgtg
gtctatgaggaggacatgtttagtgaccagaacttcctagctcaggctaccttcccagtg
aagggtctgaagacaggctacagagcggtgcctctgaagaacaactacagtgagggcctg
gagctggcctccctgctcgtcaagattgacgtgttccctgccaagcaggagaacggcgac
ctcagccccttcgggggtgcgtccctgcgggagcggagctgtgacgcctcgggcccgctg
ttccacggccgggcccgggagggctcctttgaagctcgctaccagcagccctttgaggac
ttccgcatctcccaggagcatctcgcagaccattttgacggtcgggatcgcaggacccca
cgcaggactcgggtcaacggagacaaccgcctgtag

DBGET integrated database retrieval system