KEGG   Bos taurus (cow): 282020Help
Entry
282020            CDS       T01008                                 

Gene name
PTGFR
Definition
(RefSeq) prostaglandin F2-alpha receptor
  KO
K04262  prostaglandin F receptor
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04072  Phospholipase D signaling pathway
bta04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    282020 (PTGFR)
   04072 Phospholipase D signaling pathway
    282020 (PTGFR)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282020 (PTGFR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    282020 (PTGFR)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Lipid
   Prostaglandin
    282020 (PTGFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srv Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 282020
NCBI-ProteinID: NP_851368
BGD-bta: BT26886
Ensembl: ENSBTAG00000015902
VGNC: 50147
UniProt: P37289
Position
3
AA seq 362 aa AA seqDB search
MSTNSSIQPVSPESELLSNTTCQLEEDLSISFSIIFMTVGILSNSLAIAILMKAYQRFRQ
KYKSSFLLLASALVITDFFGHLINGTIAVFVYASDKDWIYFDKSNILCSIFGICMVFSGL
CPLFLGSLMAIERCIGVTKPIFHSTKITTKHVKMMLSGVCFFAVFVALLPILGHRDYKIQ
ASRTWCFYKTDEIKDWEDRFYLLLFAFLGLLALGISFVCNAITGISLLKVKFRSQQHRQG
RSHHFEMVIQLLGIMCVSCICWSPFLVTMASIGMNIQDFKDSCERTLFTLRMATWNQILD
PWVYILLRKAVLRNLYVCTRRCCGVHVISLHVWELSSIKDSLKVAAISDLPVTEKVTQQT
ST
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgtccacgaacagttctatacagccagtgtctcctgaatctgagctcctttcaaataca
acttgccaactggaagaagacctttcaatatctttttcaataatcttcatgacagtggga
atcttatcgaacagccttgccattgctatcctcatgaaggcataccagagatttagacag
aagtataagtcatcgtttttgcttttggctagtgctctagtaatcacagatttctttggg
cacctcatcaatggaactatagcagtctttgtgtatgcttctgataaagactggatctac
tttgacaagtcaaatatcctttgcagtatttttggtatctgcatggtgttctctggtctg
tgcccactttttctaggcagtttgatggccatagagcgatgcattggagtcaccaaacca
atatttcactctacaaaaattacaaccaagcatgttaaaatgatgttgagtggggtgtgc
ttttttgctgtttttgtagctttgctgcccatcctcgggcaccgtgactataaaattcaa
gcttcaaggacctggtgtttctacaaaacagatgaaatcaaagactgggaagataggttt
tatcttttactttttgcttttctggggctcctagccctgggtatttcatttgtttgcaat
gccatcacaggaatttcacttttgaaagttaaatttagaagtcagcagcacagacaaggc
aggtctcatcactttgaaatggtcatccagcttctgggtataatgtgtgtttcctgcatt
tgttggagtccttttctggtgacaatggccagcattggaatgaatatacaagattttaag
gattcctgtgaaagaaccctttttactcttcgaatggcaacatggaatcaaatcttagat
ccttgggtgtatattcttctacggaaggctgtccttaggaacctatatgtgtgtaccaga
cgctgttgtggagtacatgtcatcagcttacatgtttgggagcttagctccattaaagat
tccttaaaggttgctgctatttctgatttaccagttacagagaaagtaactcagcaaaca
agcacctag

DBGET integrated database retrieval system