KEGG   Bos taurus (cow): 282071
Entry
282071            CDS       T01008                                 

Gene name
SFTPC
Definition
(RefSeq) pulmonary surfactant-associated protein C precursor
Organism
bta  Bos taurus (cow)
SSDB
Motif
Pfam: SP_C-Propep BRICHOS PTPS_related DUF4330 DUF945 Sigma_reg_N DUF6479 DUF2897
Other DBs
NCBI-GeneID: 282071
NCBI-ProteinID: NP_776887
BGD-bta: BT10885
Ensembl: ENSBTAG00000012560
VGNC: 34529
UniProt: P15783
Position
8
AA seq 190 aa
MDVGSKEVLMESPPDYTAVPGGRLLIPCCPVNIKRLLIVVVVVVLVVVVIVGALLMGLHM
SQKHTEMVLEMSITGPEAQQRLALSERVGTTATFSIGSTGTVVYDYQRLLIAYKPAPGTC
CYIMKMAPQNIPSLEALTRKLQNFQAKPQVPSSKLGQEQGHDAGSAFSGDLAFLGRTVST
LCGEVPLYYT
NT seq 573 nt   +upstreamnt  +downstreamnt
atggatgtgggcagcaaagaggtcttgatggagagcccgccggactacacagcagtccct
gggggccggctcctcatcccttgctgtcccgtgaacatcaaacgccttctcatcgtggtc
gtggttgtggtccttgttgtcgtggtgatcgtaggggccctgctcatgggccttcacatg
agccagaaacatacagagatggttctagagatgagcatcacaggcccagaagcacagcaa
cgcctggccctgagtgagcgtgtgggaaccactgccactttctccattggctccactggc
actgtggtttatgactaccagcggctcctgattgcctacaagccagcccccggaacctgc
tgctacatcatgaagatggctccgcagaacatcccaagtctcgaggctctcaccagaaaa
ttgcagaacttccaggccaagccccaagtgccttcctcgaagctgggccaggagcagggc
catgacgctggctcagcattctctggggacctggccttcctgggcaggaccgtgagcacc
ctgtgtggcgaggtgcccctgtactacacctag

DBGET integrated database retrieval system