KEGG   Bos taurus (cow): 282082
Entry
282082            CDS       T01008                                 

Gene name
SSRP1
Definition
(RefSeq) FACT complex subunit SSRP1
  KO
K09272  structure-specific recognition protein 1
Organism
bta  Bos taurus (cow)
Brite
KEGG Orthology (KO) [BR:bta00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bta03000]
    282082 (SSRP1)
Transcription factors [BR:bta03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   HMG2-related
    282082 (SSRP1)
SSDB
Motif
Pfam: SSrecog Rtt106 POB3_N HMG_box HMG_box_2
Other DBs
NCBI-GeneID: 282082
NCBI-ProteinID: NP_001094511
BGD-bta: BT20528
Ensembl: ENSBTAG00000000375
VGNC: 35323
UniProt: A6QQT5
Position
15
AA seq 709 aa
MAETLEFNDVYQEVKGSMNDGRLRLSRQGIIFKNSKTGKVDNIQAGELTEGIWRRVALGH
GLKLLTKNGHVYKYDGFRESEFEKLSDFFKTHYRLELMEKDLCVKGWNWGTVKFGGQLLS
FDIGDQPVFEIPLSNVSQCTTGKNEVTLEFHQNDDAEVSLMEVRFYVPPTQEDGVDPVEA
FAQNVLSKADVIQATGDAICIFRELQCLTPRGRYDIRIYPTFLHLHGKTFDYKIPYTTVL
RLFLLPHKDQRQMFFVISLDPPIKQGQTRYHFLILLFSKDEDISLTLNMNEEEVEKRFEG
RLTKNMSGSLYEMVSRVMKALVNRKITVPGNFQGHSGAQCITCSYKASSGLLYPLERGFI
YVHKPPVHIRFDEISFVNFARGTTTTRSFDFEIETKQGTQYTFSSIEREEYGKLFDFVNA
KKLNIKNRGLKEGMNPSYDEYADSDEDQHDAYLERMKEEGKIREENANDSSDDSGEETDE
SFNPGEEEEDVAEEFDSNASASSSSNEGDSDREEKKRKQLKKAKMAKDRKSRKKPLEVKK
GKDPNAPKRPMSAYMLWLNASREKIKSDHPGISVTDLSKKAGEIWKGMSKEKKEEWDRKA
EDARREYEKAMKEYEGGRGESSKRDKSKKKKKVKVKMEKKSTPSRGSSSKSSSRQLSESF
KSKEFVSSDESSSGENKGKKKRRRSEDSEEEELASTPPSSEDSASGSDE
NT seq 2130 nt   +upstreamnt  +downstreamnt
atggcagaaaccctggagttcaacgacgtgtatcaggaggtgaagggctccatgaatgat
ggtcggctgaggctgagccgccagggcatcatctttaagaacagtaagacgggcaaggtg
gacaacattcaggccggggagctgaccgaaggcatctggcgccgggtggctctgggccac
gggcttaaactgctcacgaagaacggccatgtctataagtatgacggcttccgggaatcg
gagtttgagaaactctctgatttcttcaaaactcactatcgcctggagctaatggagaag
gacttgtgtgtgaagggctggaactggggaaccgtgaagtttggtgggcagctgctttcc
ttcgacattggcgaccagccggtcttcgagatccctctcagcaatgtgtcccagtgcacc
accggcaagaacgaggtgacgctggaattccaccagaacgatgatgcagaggtctccctc
atggaggtgcgcttctacgtgccgcccacccaggaggacggcgtggaccccgtcgaggcc
tttgcccagaacgtgctgtcgaaggcggacgtgatccaggccaccggagacgccatctgc
atcttccgggagctgcagtgtctgacgccccgaggccgctacgacatccgcatctacccc
accttcctgcacctgcacgggaagaccttcgactacaagatcccctacaccacggtgctg
cggctcttcctgctgccccacaaggaccagcgccagatgttcttcgtgatcagcctggac
ccccccatcaagcagggtcagactcgctaccacttcctcatcctgctcttctccaaggac
gaggacatctccctgacgctcaacatgaacgaggaggaggtggagaagcgctttgagggg
cggctcaccaagaacatgtcaggatccctctacgagatggtcagccgggtcatgaaagcg
ctggtgaaccgcaagatcacggtcccgggcaatttccaagggcactcgggggcccagtgc
atcacctgctcctacaaggccagctcagggctgctgtaccccctggagcggggcttcatc
tacgtccacaagccgcccgtgcacatccgcttcgacgagatctcctttgtcaacttcgcc
cgcgggaccaccaccacgcgttcctttgactttgaaattgagaccaagcagggcacccag
tataccttcagcagcattgagagggaggagtacggcaagctgttcgactttgtcaatgct
aagaagctcaacatcaaaaaccgagggctgaaagagggcatgaaccccagctacgacgaa
tacgccgactcggacgaagaccagcacgacgcctacctggaacggatgaaggaggagggc
aagatccgcgaggagaacgccaacgacagcagcgatgactcgggagaggagaccgatgag
tccttcaacccgggtgaagaggaggaggatgtggcagaggagtttgacagcaatgcctcc
gccagctcctccagtaacgagggcgacagcgaccgggaagagaagaaacggaagcagctt
aaaaaggccaagatggccaaggaccgcaagagccgcaagaagcccctggaggtgaagaag
ggcaaggaccccaatgcccccaagaggcccatgtctgcctacatgctgtggctgaatgcc
agccgggagaagatcaagtcagaccatccgggcatcagcgtcacggacctctccaagaag
gcgggtgagatctggaagggaatgtccaaggagaagaaggaggagtgggatcgcaaggct
gaggatgccaggagggaatatgaaaaagccatgaaggaatacgaaggcggccgtggagag
tcttccaagagggacaagtccaagaagaagaagaaagtcaaagtgaagatggagaaaaaa
tctacaccctcccggggctcatcatcgaagtcttcatcaaggcagctgagcgagagcttc
aagagcaaagagtttgtgtccagtgacgagagctcttccggagaaaacaagggcaaaaag
aagagaaggcggagtgaggactccgaagaagaggaactagccagtactccccctagctca
gaagactcggcatcaggatctgatgaatag

DBGET integrated database retrieval system