KEGG   Bos taurus (cow): 282088Help
Entry
282088            CDS       T01008                                 

Gene name
TACR2
Definition
(RefSeq) substance-K receptor
  KO
K04223  tachykinin receptor 2
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    282088 (TACR2)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282088 (TACR2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    282088 (TACR2)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Peptide
   Tachykinin
    282088 (TACR2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4
Motif
Other DBs
NCBI-GeneID: 282088
NCBI-ProteinID: NP_776894
BGD-bta: BT27208
Ensembl: ENSBTAG00000021664
VGNC: 35561
UniProt: P05363
Position
28
AA seq 384 aa AA seqDB search
MGACVVMTDINISSGLDSNATGITAFSMPGWQLALWTAAYLALVLVAVMGNATVIWIILA
HQRMRTVTNYFIVNLALADLCMAAFNAAFNFVYASHNIWYFGRAFCYFQNLFPITAMFVS
IYSMTAIAADRYMAIVHPFQPRLSAPGTRAVIAGIWLVALALAFPQCFYSTITTDEGATK
CVVAWPEDSGGKMLLLYHLIVIALIYFLPLVVMFVAYSVIGLTLWRRSVPGHQAHGANLR
HLQAKKKFVKTMVLVVVTFAICWLPYHLYFILGTFQEDIYCHKFIQQVYLALFWLAMSST
MYNPIIYCCLNHRFRSGFRLAFRCCPWVTPTEEDKMELTYTPSLSTRVNRCHTKEIFFMS
GDVAPSEAVNGQAESPQAGVSTEP
NT seq 1155 nt NT seq  +upstreamnt  +downstreamnt
atgggggcctgtgtcgtgatgaccgatatcaacatctcgtctggccttgacagcaatgcc
acgggcatcacagccttctccatgcccggctggcagctggcactgtggaccgcagcctac
ctggccctggtgctggtggctgtgatgggcaatgccacagtcatctggatcattctggcc
catcagaggatgcgcacggtgaccaactacttcatcgtcaacctggccctggccgacctc
tgcatggctgccttcaacgctgccttcaacttcgtctacgccagccacaacatctggtac
tttggccgtgccttctgctacttccaaaacctcttccccatcacagccatgttcgtcagt
atctactccatgactgccattgctgctgacaggtacatggccatcgtccaccccttccag
ccccggctctcagctcctggcaccagagcggtcattgctggcatctggctggtggccctg
gccctcgccttcccccaatgcttctattccaccatcaccacggatgagggtgccaccaag
tgcgtggtggcctggcctgaagacagcggtggcaagatgctccttttgtaccacctcata
gtgatcgccctcatttacttcctgcctctcgtggtgatgttcgtcgcctacagtgtcatc
ggactcacgctctggagacgctctgtcccggggcaccaggctcatggtgccaacttgcgc
cacctgcaggccaagaagaagttcgtgaagaccatggtgctggtggtggtgacgtttgcc
atctgctggctgccctaccacctctacttcatcctgggcaccttccaggaggacatctac
tgccacaagttcatccagcaggtctacctggcgctcttctggctggccatgagctccacc
atgtacaatcccatcatttactgctgcctcaaccacaggtttcgctctggattccggctt
gctttccgttgctgtccatgggtcacaccaaccgaggaggacaagatggagctgacctac
actccatccctctccacgagggtcaacaggtgtcacactaaagagatttttttcatgtct
ggggatgtggccccctctgaggctgtcaacgggcaggctgaaagcccccaggctggagtg
tctactgaaccctaa

DBGET integrated database retrieval system