KEGG   Bos taurus (cow): 282133Help
Entry
282133            CDS       T01008                                 

Gene name
ADORA1
Definition
(RefSeq) adenosine receptor A1
  KO
K04265  adenosine receptor A1
Organism
bta  Bos taurus (cow)
Pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04071  Sphingolipid signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04923  Regulation of lipolysis in adipocytes
bta04924  Renin secretion
bta05032  Morphine addiction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    282133 (ADORA1)
   04024 cAMP signaling pathway
    282133 (ADORA1)
   04022 cGMP-PKG signaling pathway
    282133 (ADORA1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282133 (ADORA1)
 09150 Organismal Systems
  09152 Endocrine system
   04923 Regulation of lipolysis in adipocytes
    282133 (ADORA1)
   04924 Renin secretion
    282133 (ADORA1)
 09160 Human Diseases
  09165 Substance dependence
   05032 Morphine addiction
    282133 (ADORA1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    282133 (ADORA1)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Base and nucleoside
   Adenosine
    282133 (ADORA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 282133
NCBI-ProteinID: NP_776922
BGD-bta: BT18639
Ensembl: ENSBTAG00000011461
VGNC: 25686
UniProt: P28190
Position
16
AA seq 326 aa AA seqDB search
MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPRTYFHTCLKVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKTVVT
PRRAVVAITGCWILSFVVGLTPMFGWNNLSAVERDWLANGSVGEPVIECQFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYMEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHMPRILIYIAIFLSHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPVDEDAPAERPDD
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctccatctcggccttccaggccgcatatattggcatcgaggtgctcatcgcc
ctggtctctgtgcctgggaacgtgctggtgatctgggcggtgaaggtgaatcaggccttg
cgggatgccaccttctgcttcatcgtgtcactggcagtggctgatgtggcggtgggcgct
ctggtcatcccgctcgccatcctcatcaacattgggccacggacctacttccacacctgc
ctcaaggtcgcctgccctgtcctcatcctcactcagagctccatcctggccctgctggca
attgctgttgaccgctacctccgtgtcaagatcccactcaggtacaagacagtggtgact
cctcgaagggctgtggtggccatcactggctgctggattctctccttcgtggtgggcctg
acgcccatgttcggctggaacaacctgagcgcggtggagcgggactggctggccaatggc
agcgtgggcgagcctgtgattgaatgccagttcgagaaggtcatcagcatggagtacatg
gtctacttcaacttcttcgtgtgggtgctgcccccgctgctgctcatggtcctcatctac
atggaggtcttctatctgatccgcaagcagctcaacaagaaggtgtcggcctcctccgga
gacccgcagaagtactatgggaaggagctgaagatcgccaagtcgctggccctcatcctc
ttcctcttcgccctcagctggctgcccttgcacatcctcaactgcatcaccctcttctgc
ccttcctgccacatgcccaggatcctcatatacatcgccatcttcctctcacacggcaac
tcggccatgaaccccatcgtctacgccttccgcatccagaagtttcgagtgaccttcctt
aagatctggaatgaccacttccgctgccagcctgcaccccccgttgatgaggatgcccca
gcagagagacccgatgactag

DBGET integrated database retrieval system