KEGG   Bos taurus (cow): 282134Help
Entry
282134            CDS       T01008                                 

Gene name
ADRA1A
Definition
(RefSeq) alpha-1A adrenergic receptor
  KO
K04135  adrenergic receptor alpha-1A
Organism
bta  Bos taurus (cow)
Pathway
bta04020  Calcium signaling pathway
bta04022  cGMP-PKG signaling pathway
bta04080  Neuroactive ligand-receptor interaction
bta04152  AMPK signaling pathway
bta04261  Adrenergic signaling in cardiomyocytes
bta04270  Vascular smooth muscle contraction
bta04970  Salivary secretion
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    282134 (ADRA1A)
   04022 cGMP-PKG signaling pathway
    282134 (ADRA1A)
   04152 AMPK signaling pathway
    282134 (ADRA1A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282134 (ADRA1A)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    282134 (ADRA1A)
   04270 Vascular smooth muscle contraction
    282134 (ADRA1A)
  09154 Digestive system
   04970 Salivary secretion
    282134 (ADRA1A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    282134 (ADRA1A)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    282134 (ADRA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7TM_GPCR_Srv 7tm_4
Motif
Other DBs
NCBI-GeneID: 282134
NCBI-ProteinID: NP_776923
BGD-bta: BT22464
VGNC: 25693
UniProt: P18130
Position
8
AA seq 466 aa AA seqDB search
MVFLSGNASDSSNCTHPPPPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEILGYWAFGRVFCNVWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQKRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYVPLTIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
AQVGGSGVTSAKNKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FRPSETVFKIAFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLRRKQSSKHTLGYTL
HAPSHVLEGQHKDLVRIPVGSAETFYKISKTDGVCEWKIFSSLPRGSARMAVARDPSACT
TARVRSKSFLQVCCCLGPSTPSHGENHQIPTIKIHTISLSENGEEV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggtgtttctctccggaaatgcctccgacagctccaactgcacccacccgccgccaccg
gtgaacatttccaaggccattctgctcggggtgatcttggggggcctcatccttttcggg
gtactggggaacatcctcgtgatcctttccgtggcctgccaccggcacctgcactcggtc
acacactactacatcgtcaacctggcggtggccgaccttctcctcacttccacggtgctg
cccttctccgctatcttcgagatcttgggctactgggccttcggcagggtcttctgcaat
gtctgggcggcggtggacgtcctgtgctgcacggcttccatcatgggactctgcatcatc
tccatcgaccgctacatcggcgtgagctatcctctgcgctaccccaccatcgtcacccag
aagaggggcctcatggccctgctctgcgtctgggcgctctctttggtcatctccatcggg
cccctcttcggctggaggcagccggccccggaggacgagaccatctgccagatcaacgag
gagccgggctacgtgctcttctcggctctgggctccttctacgtgccgctgaccatcatc
ctggtcatgtactgccgggtctacgtcgtggccaagagggagagccggggcctcaagtcg
ggccttaagaccgacaagtcagactcggagcaggtgacgctccgcatccatcgcaaaaac
gcccaggtaggaggcagcggggtgaccagcgccaagaacaagacgcacttctccgtgaga
ctgctcaaattttcccgcgagaagaaagcggccaaaacgctgggcatcgtggtcggctgc
ttcgtcctctgctggctgccttttttcttagtgatgcccattgggtctttctttcctgat
ttcaggccctcagaaaccgtttttaaaatagcattttggctcggttacctaaacagctgc
atcaaccccattatatacccatgctccagtcaagagtttaaaaaggcctttcagaatgtc
ttgagaatccagtgtctgcgacgaaagcagtcctccaaacacaccctgggctacacgctg
cacgcacccagccacgtcctggagggacagcacaaggacctggttcgcattccggtggga
tctgcagagaccttctataagatctccaagacggatggggtctgtgaatggaaaattttc
tcttccctaccccgcggatctgccaggatggcggtggccagagacccatcagcctgcacc
actgcccgggtgagaagtaaaagctttttgcaagtgtgctgttgcctggggccctcgacc
cccagtcatggagagaatcatcagattccgaccattaagatccacaccatctccctcagt
gaaaatggggaggaagtctaa

DBGET integrated database retrieval system