KEGG   Bos taurus (cow): 282135Help
Entry
282135            CDS       T01008                                 

Gene name
ADRA2A
Definition
(RefSeq) alpha-2A adrenergic receptor
  KO
K04138  adrenergic receptor alpha-2A
Organism
bta  Bos taurus (cow)
Pathway
bta04022  cGMP-PKG signaling pathway
bta04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    282135 (ADRA2A)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282135 (ADRA2A)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:bta04030]
    282135 (ADRA2A)
G protein-coupled receptors [BR:bta04030]
 Rhodopsin family
  Biogenic amine
   Adrenaline
    282135 (ADRA2A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7tm_4 7TM_GPCR_Srx T2SSM
Motif
Other DBs
NCBI-GeneID: 282135
NCBI-ProteinID: NP_776924
BGD-bta: BT11526
UniProt: Q28838
Position
26
AA seq 452 aa AA seqDB search
MGSLQPDAGNASWNGTEAPGGGARATPYSLQVTLTLVCLAGLLMLFTVFGNVLVIIAVFT
SRALKAPQNLFLVSLASADILVATLVIPFSLANEVMGYWYFGKAWCEIYLALDVLFCTSS
IVHLCAISLDRYWSITQAIEYNLKRTPRRIKAIIVTVWVISAVISFPPLISFEKKRGRSG
QPSAEPRCEINDQKWYVISSSIGSFFAPCLIMILVYVRIYQIAKRRTRVPPSRRGPDATA
AELPGSAERRPNGLGPERGGVGPVGAEVESLQVQLNGAPGEPAPAGAGADALDLEESSSS
EHAERPPGSRRSERGPRAKGKARASQVKPGDSLPRRGPGATGLGAPTAGPAEERSGGGAK
ASRWRGRQNREKRFTFVLAVVIGVFVVCWFPFFFTYTLTAIGCPVPPTLFKFFFWFGYCN
SSLNPVIYTIFNHDFRRAFKKILCRGDRKRIV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgggctccctgcagccggacgcgggcaacgcgagctggaacgggaccgaggccccgggg
ggcggcgcccgggccaccccctactccctgcaggtgacgctgacgctggtgtgcctggct
ggcctgctcatgctgttcacagtgttcggtaacgtgcttgtcatcattgctgtgttcaca
agccgcgcgctcaaggcgccccagaatctcttcctggtgtctctggcttcggcggacatc
ctggtggccacgcttgtcatccctttctcgctggccaacgaggtcatgggctactggtac
ttcggcaaggcgtggtgtgagatctacctggcgctcgacgtgctcttctgcacgtcttcc
atagtgcacctgtgcgccatcagcctggatcgttactggtccatcacccaggccatagag
tacaacctgaagcgcacgccacgccgcatcaaggccatcatcgtcacggtgtgggtcatc
tcggccgtcatctccttccccccgctcatttccttcgagaagaagagaggcaggagtggc
cagccgtccgccgaaccgcgctgtgagatcaacgaccagaagtggtacgtcatctcgtcg
agcatcggctccttcttcgcgccctgcctgatcatgatcctggtctatgtgcgcatctac
cagatcgccaagcgccgcacccgcgtgccgcccagtcgccggggtcccgatgccaccgcc
gctgagctgccagggagcgccgagcgcaggcccaacggcttgggcccggagcgcggcggc
gtgggccccgtgggcgccgaggtcgagtcgctgcaggtccagctcaatggtgccccgggg
gagcccgcgcccgcaggcgccggagccgacgcgctggacctagaggagagctcctcgtct
gagcatgctgagcggcccccggggtcccgcaggtcggagcgcgggccccgggccaaaggc
aaggcccgggcgagccaggtgaagcccggggacagcctgccgcggcgcgggccgggggcg
acggggctgggggcacccacggccgggccggcggaggagcgctctggcgggggcgccaag
gcgtcgcgctggcgcgggcggcagaaccgcgagaagcgcttcaccttcgtgctggcggtg
gtcatcggagtgttcgtggtgtgctggttccccttcttcttcacctacacgctcacggcc
atcggctgccccgtgccgcccacgctcttcaagttcttcttctggttcggctactgcaac
agctcgctgaacccggtcatatacaccatcttcaatcacgacttccgccgcgccttcaag
aagatcctctgccggggggacaggaagcggatcgtgtga

DBGET integrated database retrieval system