KEGG   Bos taurus (cow): 282138Help
Entry
282138            CDS       T01008                                 

Gene name
AKR1C4
Definition
(RefSeq) dihydrodiol dehydrogenase 3
  KO
K04119  aldo-keto reductase family 1 member C3 [EC:1.1.1.51 1.1.1.188 1.1.1.213 1.1.1.357]
Organism
bta  Bos taurus (cow)
Pathway
bta00140  Steroid hormone biosynthesis
bta00590  Arachidonic acid metabolism
bta00790  Folate biosynthesis
bta01100  Metabolic pathways
bta04913  Ovarian steroidogenesis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    282138 (AKR1C4)
   00590 Arachidonic acid metabolism
    282138 (AKR1C4)
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    282138 (AKR1C4)
 09150 Organismal Systems
  09152 Endocrine system
   04913 Ovarian steroidogenesis
    282138 (AKR1C4)
Enzymes [BR:bta01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.51  3(or 17)beta-hydroxysteroid dehydrogenase
     282138 (AKR1C4)
    1.1.1.188  prostaglandin-F synthase
     282138 (AKR1C4)
    1.1.1.213  3alpha-hydroxysteroid 3-dehydrogenase (Re-specific)
     282138 (AKR1C4)
    1.1.1.357  3alpha-hydroxysteroid 3-dehydrogenase
     282138 (AKR1C4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldo_ket_red
Motif
Other DBs
NCBI-GeneID: 282138
NCBI-ProteinID: NP_851370
BGD-bta: BT23296
Ensembl: ENSBTAG00000022564
UniProt: P52898
Position
13
AA seq 323 aa AA seqDB search
MDPKGQRVKLNDGHFIPVLGFGTFAPREVPKSEALEVTKFAIEAGFRHIDSAHLYQNEEQ
VGQAIRSKIADGTVKREDIFYTSKLWSTSLRPELVRPALEKSLNNLQLDYVDLYIIHFPV
ALKPGETLFPTDENGKPIFDSVDLCRTWEALEKCKDAGLTKSIGVSNFNHKQLEKILNKP
GLKYKPVCNQVECHPYFNQSKLLDFCKSHDIVLVAYGALGSQRLKEWVNPNLPFLLEDPV
LSAIAKKHRQTPALVALRYQIQRGVVVLAKSYNKKRIKENIQVFDFELTPEDMKAIDGLN
SNMRYNELLLGVGHPEYPFVEEY
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggatcccaaaggccagagagtgaagcttaatgatggccacttcattcctgtcctggga
tttggaacctttgcacctcgagaggttcctaagagtgaagctctggaagtcaccaaattt
gctatagaggctgggttccgccatattgacagtgctcatttgtaccaaaatgaagagcag
gttggccaggccattcgaagcaagattgccgatggcactgtaaagagagaagacattttc
tacacttcaaagctttggtccacttcccttcgtccagaattggtccgaccagccttggaa
aagtcactgaataatcttcaactggactatgtcgatctttatattattcattttccagtg
gctctgaagccaggggagacacttttcccaacagatgaaaatggaaaaccaatatttgac
tcagtggatctctgtcgcacatgggaggccctggagaagtgtaaggacgcagggctgacc
aagtccatcggggtgtccaacttcaaccacaagcagctggagaagatcctgaacaagcca
gggcttaagtacaagcccgtctgcaaccaggtggaatgtcacccttatttcaatcagagc
aaactgttggatttctgcaagtcacatgatattgttcttgttgcctatggtgctctggga
tcccaacgactaaaagaatgggtgaacccaaacctcccctttctcttggaggacccagtt
ctctctgccattgccaaaaagcacaggcaaaccccagctctggttgcccttcgctaccag
atacaacgtggggttgtggttctggccaagagttacaacaagaagcggatcaaagagaac
atacaggtgtttgactttgaactgactccagaagatatgaaagcaatcgatggcctcaac
agcaatatgagatataatgagctattactgggtgttggtcaccctgagtatccatttgtt
gaagaatattga

DBGET integrated database retrieval system