KEGG   Bos taurus (cow): 282143
Entry
282143            CDS       T01008                                 

Gene name
APLN
Definition
(RefSeq) apelin precursor
  KO
K05225  apelin
Organism
bta  Bos taurus (cow)
Pathway
bta04080  Neuroactive ligand-receptor interaction
bta04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    282143 (APLN)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    282143 (APLN)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 282143
NCBI-ProteinID: NP_776928
BGD-bta: BT10310
Ensembl: ENSBTAG00000019993
VGNC: 26017
UniProt: Q9TUI9
Position
X
AA seq 77 aa
MNLRRCVQALLLLWLCLSAVCGGPLLQTSDGKEMEEGTIRYLVQPRGPRSGPGPWQGGRR
KFRRQRPRLSHKGPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatctgcggcgctgcgtgcaggcgctcctgctgctctggctctgcctgagcgcggtg
tgcggaggacccctgctgcagacttctgacgggaaggagatggaagaaggcaccatccga
tacctggtgcagcccagggggccgaggagcggcccaggcccctggcagggaggtcggagg
aagttccggcgccagcggccacgcctctcccacaagggtcccatgcctttctga

DBGET integrated database retrieval system