KEGG   Bos taurus (cow): 282144Help
Entry
282144            CDS       T01008                                 

Gene name
ATP1A1
Definition
(RefSeq) sodium/potassium-transporting ATPase subunit alpha-1
  KO
K01539  sodium/potassium-transporting ATPase subunit alpha [EC:7.2.2.13]
Organism
bta  Bos taurus (cow)
Pathway
bta04022  cGMP-PKG signaling pathway
bta04024  cAMP signaling pathway
bta04260  Cardiac muscle contraction
bta04261  Adrenergic signaling in cardiomyocytes
bta04911  Insulin secretion
bta04918  Thyroid hormone synthesis
bta04919  Thyroid hormone signaling pathway
bta04925  Aldosterone synthesis and secretion
bta04960  Aldosterone-regulated sodium reabsorption
bta04961  Endocrine and other factor-regulated calcium reabsorption
bta04964  Proximal tubule bicarbonate reclamation
bta04970  Salivary secretion
bta04971  Gastric acid secretion
bta04972  Pancreatic secretion
bta04973  Carbohydrate digestion and absorption
bta04974  Protein digestion and absorption
bta04976  Bile secretion
bta04978  Mineral absorption
Brite
KEGG Orthology (KO) [BR:bta00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04024 cAMP signaling pathway
    282144 (ATP1A1)
   04022 cGMP-PKG signaling pathway
    282144 (ATP1A1)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    282144 (ATP1A1)
   04918 Thyroid hormone synthesis
    282144 (ATP1A1)
   04919 Thyroid hormone signaling pathway
    282144 (ATP1A1)
   04925 Aldosterone synthesis and secretion
    282144 (ATP1A1)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    282144 (ATP1A1)
   04261 Adrenergic signaling in cardiomyocytes
    282144 (ATP1A1)
  09154 Digestive system
   04970 Salivary secretion
    282144 (ATP1A1)
   04971 Gastric acid secretion
    282144 (ATP1A1)
   04972 Pancreatic secretion
    282144 (ATP1A1)
   04976 Bile secretion
    282144 (ATP1A1)
   04973 Carbohydrate digestion and absorption
    282144 (ATP1A1)
   04974 Protein digestion and absorption
    282144 (ATP1A1)
   04978 Mineral absorption
    282144 (ATP1A1)
  09155 Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    282144 (ATP1A1)
   04961 Endocrine and other factor-regulated calcium reabsorption
    282144 (ATP1A1)
   04964 Proximal tubule bicarbonate reclamation
    282144 (ATP1A1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bta04147]
    282144 (ATP1A1)
Enzymes [BR:bta01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.13  Na+/K+-exchanging ATPase
     282144 (ATP1A1)
Exosome [BR:bta04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   282144 (ATP1A1)
  Exosomal proteins of other body fluids (saliva and urine)
   282144 (ATP1A1)
  Exosomal proteins of colorectal cancer cells
   282144 (ATP1A1)
  Exosomal proteins of bladder cancer cells
   282144 (ATP1A1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Cation_ATPase Hydrolase Cation_ATPase_N Hydrolase_3 DUF1290 DUF4455
Motif
Other DBs
NCBI-GeneID: 282144
NCBI-ProteinID: NP_001070266
BGD-bta: BT11164
Ensembl: ENSBTAG00000001246
VGNC: 26282
UniProt: Q08DA1
Structure
PDB: 

Position
3
AA seq 1021 aa AA seqDB search
MGKGVGRDKYEPAAVSEHGDKKKAKKERDMDELKKEVSMDDHKLSLDELHRKYGTDLSRG
LTTARAAEILARDGPNALTPPPTTPEWVKFCRQLFGGFSMLLWIGAVLCFLAYGIQAATE
EEPQNDNLYLGVVLSAVVIITGCFSYYQEAKSSKIMESFKNMVPQQALVIRNGEKMSINA
EEVVVGDLVEVKGGDRIPADLRIISANGCKVDNSSLTGESEPQTRSPDFTNENPLETRNI
AFFSTNCVEGTARGIVVYTGDRTVMGRIATLASGLEGGQTPIAAEIEHFIHIITGVAVFL
GVSFFILSLILEYTWLEAVIFLIGIIVANVPEGLLATVTVCLTLTAKRMARKNCLVKNLE
AVETLGSTSTICSDKTGTLTQNRMTVAHMWFDNQIHEADTTENQSGVSFDKTSATWLALS
RIAGLCNRAVFQANQDNLPILKRAVAGDASESALLKCIEVCCGSVKEMRERYTKIVEIPF
NSTNKYQLSIHKNANAGEPRHLLVMKGAPERILDRCSSILIHGKEQPLDEELKDAFQNAY
LELGGLGERVLGFCHLLLPDEQFPEGFQFDTDDVNFPVDNLCFVGLISMIDPPRAAVPDA
VGKCRSAGIKVIMVTGDHPITAKAIAKGVGIISEGNETVEDIAARLNIPVSQVNPRDARA
CVVHGSDLKDMTPEQLDDILKYHTEIVFARTSPQQKLIIVEGCQRQGAIVAVTGDGVNDS
PALKKADIGVAMGIAGSDVSKQAADMILLDDNFASIVTGVEEGRLIFDNLKKSIAYTLTS
NIPEITPFLIFIIANIPLPLGTVTILCIDLGTDMVPAISLAYEQAESDIMKRQPRNPQTD
KLVNERLISMAYGQIGMIQALGGFFTYFVIMAENGFLPNHLLGIRVTWDDRWINDVEDSY
GQQWTYEQRKIVEFTCHTAFFVSIVVVQWADLVICKTRRNSVFQQGMKNKILIFGLFEET
ALAAFLSYCPGMGVALRMYPLKPTWWFCAFPYSLLIFVYDEVRKLIIRRRPGGWVEKETY
Y
NT seq 3066 nt NT seq  +upstreamnt  +downstreamnt
atggggaagggggttggacgtgataaatatgaaccggcagctgtttcagagcatggggac
aagaaaaaagccaagaaagagagggatatggacgagctgaagaaagaagtttctatggat
gatcataaacttagccttgatgaacttcatcgcaaatatggaacagacttgagccgaggc
ttaacaactgctcgagctgccgagatcctagccagagatggacccaacgccctcacgccc
cctcccacgacccctgaatgggtcaagttctgtcgacagctgtttggggggttctcaatg
ttactgtggattggagcagttctttgcttcctggcctatggtatccaagctgctacagaa
gaggaacctcaaaatgataatctgtaccttggtgtggtgctgtctgctgtcgtcatcata
accgggtgtttctcctactatcaagaagctaaaagctcaaagatcatggagtccttcaaa
aacatggttcctcagcaagccctcgtgattcgaaatggtgagaaaatgagcataaatgcg
gaagaggttgtcgtcggagatctggtggaagtgaaaggaggggatcgaattcctgccgat
ctcaggatcatttctgcaaatggctgcaaggtggataactcctcactcacgggagaatca
gagccacagaccaggtctccggatttcaccaatgaaaatcccctggagacacggaacatt
gcctttttttcaactaactgtgttgaaggcactgcacgtggcattgtcgtgtatactggg
gatcgaaccgtgatgggcagaattgccacgctggcttctgggctggaggggggccagact
cccatcgctgcggaaattgaacattttatccacatcatcacgggtgtggctgtgttcctg
ggcgtgtcgttcttcatcctttctctgatccttgagtacacctggctggaggctgtcatc
ttcctcatcggcatcattgtagccaacgtgccagagggtttgctggccaccgtcacggtg
tgcctgacgctgactgcaaagcgcatggccaggaaaaactgcttagtgaagaacctggag
gctgtggagaccttgggatccacgtccaccatctgctcagacaaaactggaactctgacc
cagaaccgaatgacagtggcccacatgtggttcgacaaccaaatccacgaggcggacacg
acagagaatcagagcggtgtttcatttgacaagacttcggccacgtggctcgctctgtcc
agaattgcaggtctttgtaacagggccgtgtttcaggctaaccaggataacctgcctatc
ctgaagcgggctgtagcgggtgatgcctcagagtctgcgctcctgaagtgcattgaggtg
tgctgcggttctgtgaaggagatgagagagagatacaccaagatcgtcgagatcccattc
aactccaccaacaagtaccagttatccatccacaagaacgccaatgcaggtgagccccgg
cacctactggtgatgaaaggtgccccagaaaggatcttggaccgctgcagctccatcctc
atccatggcaaggagcagcccctggacgaggagctgaaggacgcttttcagaatgcctac
ctggagctgggtggcctcggagagcgtgtgctgggtttttgccacttgctgctgccagat
gagcagtttcctgaaggcttccagtttgacaccgacgatgtgaacttccctgttgataat
ctctgcttcgtgggactcatctccatgattgacccaccacgggctgctgtcccagatgct
gtgggcaaatgccgaagtgctggaatcaaggtcatcatggtcaccggagaccatcccatc
actgccaaagccattgccaaaggtgtggggatcatctcagaaggtaatgagactgtagaa
gacattgctgcccgcctcaacatcccagtgagccaggtgaaccccagggatgcccgggcc
tgcgtggtgcatggaagtgatctgaaggacatgactcccgagcagctggatgacatcttg
aagtaccacacagagattgtgttcgccaggacctctccgcagcagaagctcatcattgtg
gaaggctgccagagacagggtgccatcgtggctgtaactggagacggtgtcaatgactcc
ccggctttgaagaaggcagacattggggttgccatggggattgcaggctcagacgtgtct
aagcaagctgctgacatgattctcctagatgacaactttgcctcaattgtgactggagta
gaggaaggtcgtctgatctttgataacttgaagaaatccattgcttataccctcaccagt
aacattcctgagattacccccttcctgatatttattattgcaaacattccactccctctg
gggaccgtcaccatcctctgcatcgacttgggaacggacatggtccctgctatctccttg
gcttatgagcaggctgagagcgacatcatgaagaggcagcccagaaacccccagacggac
aaactcgtgaacgagcggctgatcagcatggcctatggacagattggtatgatccaggcc
ctggggggcttcttcacttactttgttatcatggctgagaacggcttcctcccaaatcac
ctgctgggcatccgagtgacctgggatgaccgttggatcaacgatgtggaggacagctat
gggcagcagtggacctatgaacagaggaagattgtggagttcacctgccacacggccttc
tttgtcagtatcgtggtggtgcagtgggctgacctggtcatctgcaagaccaggaggaat
tctgtcttccagcaggggatgaagaacaagatcttaatatttggcctctttgaagagaca
gcccttgctgctttcctttcctactgccctggaatgggtgttgccctgaggatgtatccc
ctcaaacctacctggtggttctgtgccttcccctactctcttctcatcttcgtgtatgac
gaagtccggaagctcatcatcaggcgacgtcctggcggttgggtggagaaggagacctac
tactag

DBGET integrated database retrieval system