KEGG   Bos taurus (cow): 282166
Entry
282166            CDS       T01008                                 

Symbol
CATHL4
Name
(RefSeq) cathelicidin-4 precursor
  KO
K13916  cathelicidin antimicrobial peptide
Organism
bta  Bos taurus (cow)
Pathway
bta04613  Neutrophil extracellular trap formation
bta04621  NOD-like receptor signaling pathway
bta04970  Salivary secretion
bta05150  Staphylococcus aureus infection
bta05152  Tuberculosis
Brite
KEGG Orthology (KO) [BR:bta00001]
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    282166 (CATHL4)
   04621 NOD-like receptor signaling pathway
    282166 (CATHL4)
  09154 Digestive system
   04970 Salivary secretion
    282166 (CATHL4)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    282166 (CATHL4)
   05152 Tuberculosis
    282166 (CATHL4)
SSDB
Motif
Pfam: Cathelicidins Spp-24 SAG Cystatin SLD5_C
Other DBs
NCBI-GeneID: 282166
NCBI-ProteinID: NP_777252
Ensembl: ENSBTAG00000020072
UniProt: P33046
Structure
Position
22:complement(51592817..51594189)
AA seq 144 aa
MQTQRASLSLGRWSLWLLLLGLVVPSASAQALSYREAVLRAVDQLNELSSEANLYRLLEL
DPPPKDNEDLGTRKPVSFTVKETVCPRTIQQPAEQCDFKEKGRVKQCVGTVTLDPSNDQF
DLNCNELQSVILPWKWPWWPWRRG
NT seq 435 nt   +upstreamnt  +downstreamnt
atgcagacccagagggccagcctctcactggggcggtggtcgctgtggctactgctgctg
ggactagtggtgccctcggccagcgcccaagccctcagctacagggaggccgtgcttcgt
gctgtggatcagctcaatgagctgtcctcagaagctaatctctaccgcctcctggagcta
gacccacctcccaaggataatgaagatctgggcactcgaaagcctgtgagcttcacggtg
aaggagactgtgtgccccaggacgattcagcagcccgcggagcagtgtgacttcaaggag
aaagggcgggtgaaacagtgtgtggggacagtcaccctggacccatccaatgaccagttt
gacctaaactgtaatgagctccagagtgtcatcctaccctggaaatggccatggtggcct
tggcgcagaggttga

DBGET integrated database retrieval system